Conserved Protein Domain Family
trehalos_R_Ecol

?
TIGR02405: trehalos_R_Ecol 
trehalose operon repressor, proteobacterial
This family consists of repressors of the LacI family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gammaproteobacteria and does not include the GntR family TreR of Bacillus subtilis [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131458
View PSSM: TIGR02405
Aligned: 3 rows
Threshold Bit Score: 552.955
Threshold Setting Gi: 46912844
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P36673     4 RLTIKDIARLSGVGKSTVSRVLNNESGVSQLTRERVEAVMNQHGFSPSRSARAMRGQSDKVVAIIVTRLDSLSENLAVQT 83  Escherichia coli K-12
CAE15663   4 KLTIKDIARLANVSKSTVSRVLNNENSVSPQVRERVETIIQQNNFIPSKSARAMRVKSDKIIALIVSRLGSFSENLSISA 83  Photorhabdus lumine...
CAG19634   4 KLTILDIAKLAGVGKSTVSRVLTNDPKVKIETRERVEQVIQESGFVPSKSAQAMRGGSAKVVGVIISRLDSPSENKAVSG 83  Photobacterium prof...
P36673    84 MLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNIDGVVLFGFTGITEEMLAHWQSSLVLLARDAKGFASVCYDDEGAI 163 Escherichia coli K-12
CAE15663  84 MLPLFYQHGYDPIIMESNFDPQLLQEHLRQLALRHADGIILFGFTGLSEESLFPWRDKMVVFAREYTGFSSVCYDDIGAV 163 Photorhabdus lumine...
CAG19634  84 ILDVIYTAGYDAVIMESQFSAEKTNEHLSVLQKRNVDGVILFGFSGCDLSIVESLNHKAVVIAVDTGRISSVGYDNYGII 163 Photobacterium prof...
P36673   164 KILMQRLYDQGHRNISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGYENVAKVITPETTALLCATDTL 243 Escherichia coli K-12
CAE15663 164 RLLMNEFYRRGHREISFLGVDDCDTTTGFLRHQSYLACCEQQGLRPLSVQCDLSYQSGFQHINKVLREKTTALICATDSL 243 Photorhabdus lumine...
CAG19634 164 ELAMANLQQQGKQHISFIGVDPSDKTTGLMRLNAYIEYCESANIEPIYQTGQLSHESAYVLTDHVLKPETEAIVCASDTL 243 Photobacterium prof...
P36673   244 ALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVDPGYAEAGRQAACQLIAQVTGRSEPQQIIIPATL 314 Escherichia coli K-12
CAE15663 244 ALGAYKYLQQNSREDIQIGSIGNTPLLNFLYPNTVSIDLGYSEAGKYASDQLISQINRQYFKQKVIIPSKL 314 Photorhabdus luminescens sub...
CAG19634 244 AMGVAKRLQELDRSDVLVSGVGATDLLSFIFPNTFSIDPGYYAAGKASASLLIKQLAGCHEVTHLTQKAMI 314 Photobacterium profundum SS9
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap