Conserved Protein Domain Family
salt_tol_Pase

?
TIGR02399: salt_tol_Pase 
glucosylglycerol 3-phosphatase
Proteins in this family are glucosylglycerol-phosphate phosphatase, with the gene symbol stpA (Salt Tolerance Protein A). A motif characteristic of acid phosphatases is found, but otherwise this family shows little sequence similarity to other phosphatases. This enzyme acts on the glucosylglycerol phosphate, product of glucosylglycerol phosphate synthase and immediate precursor of the osmoprotectant glucosylglycerol.
Statistics
?
PSSM-Id: 131452
View PSSM: TIGR02399
Aligned: 3 rows
Threshold Bit Score: 716.624
Threshold Setting Gi: 15214311
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55034    17 QTLAQTENLLIVQDLDGVCMELVQDPLSRRLDADYVRATTLFAEHFYVLTNGEHVGKRGVQGIVEQSFGDASFVQQEGLY 96  Synechocystis sp. P...
CAE21038  11 AEMVSTEDLLIVQDLDGVCIPLVKDPLTRVLDPAYVWAAKSLEGSFSVLTNGEHGGHRGVNCVVERALGDPQLPAKQGLY 90  Prochlorococcus mar...
CAE19098  10 EIIINSKNILFIQDIDGVCIPLVKDPMTRKLESKFIFAVKNLEKEFYVLTCGEHEGPRGVNRIVERSLIGIDQPKEKGLY 89  Prochlorococcus mar...
Q55034    97 LPGLAAGGVQWQDRHGKVSHPGVGQTELEFLAAVPEKITNCLKTFFGDRPHSLSPEQLQTGIEASVLDNVASPTANLNTL 176 Synechocystis sp. P...
CAE21038  91 LPGLAAGGVQLQNCYGEISHPGISDAEIAFLAALPSRMKTLLEQRLPALLPQITSDEIQTLAKMSVLDTELSPTILLNGL 170 Prochlorococcus mar...
CAE19098  90 LRGLAACGVEYQDNNGNISFEGVSKEEVDFLAKVPDLMRPSFEQIVKKIFPNLVQEEINSHASKSICKTRFSPTINFNSL 169 Prochlorococcus mar...
Q55034   177 ANLLQDFPQIYRDLQETMAQLLDQLMAEAVAQGLGNSFFVHYAPNLGRDERgKEIIRWAKAGDSGTTDFQFMLRGGVKEA 256 Synechocystis sp. P...
CAE21038 171 FSLSPDDVGIQQSLQIMLHELMNELMNSAISAGLPNSFFLHIAPNMGCDGQ-RERLKPAAPGDVGTTDIQFMLKGAVKEA 249 Prochlorococcus mar...
CAE19098 170 FDLVKDDSEKRKIIQKSFEDMMNEIIYKAKTQGLENSFFLHISPNLGSKNG-NEIIKLSSKNDIGSTDIQLLIKGAVKDS 248 Prochlorococcus mar...
Q55034   257 GVLALLNRYYHNRTGQYPLGESFSARQAPPSHQDLLHLVKAQFDPALMPLIIGVGDTVTSQVDEATGEIRRGGSDRQFLQ 336 Synechocystis sp. P...
CAE21038 250 GLVVLINKHIAKHKGRAPLGKDFDVRSAPKTHQGLLDLCRKHIPVDQMPLLMGVGDTVTSNPSPDGTGWLRGGSDRGFLT 329 Prochlorococcus mar...
CAE19098 249 GVLFLLNKFIYDSTGIAPFGRNFNFKDSPKSLIEKVNFCKKHIKPEDMPTIIGIGDTVTSQKIPN-NGYSRGGSDRSFLE 327 Prochlorococcus mar...
Q55034   337 LIQDLGDWGNHGNLVVYVDSSQGEVKnRQPLQLETVAGqtqvvagpgdMRDREEPLKINVAFPGGHDQYVAAFKQAAQRR 416 Synechocystis sp. P...
CAE21038 330 LLQNLGATYNRTNRVVLVDSSGGEVY-RPSLADERLQG----------ISDPEDPLHFDVLVPSGPSTYVAWFRSLAERR 398 Prochlorococcus mar...
CAE19098 328 FIQLLGQEFESNNKIIFVDSSSGEVY-RPSTKISGLKG----------ISDDDDNLKFDMIFQNGPKEYLDWFIKFAKNR 396 Prochlorococcus mar...
Q55034   417 R 417 Synechocystis sp. PCC 6803 substr. Kazusa
CAE21038 399 S 399 Prochlorococcus marinus str. MIT 9313
CAE19098 397 S 397 Prochlorococcus marinus subsp. pastoris str. CCMP1986
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap