Conserved Protein Domain Family
gluc_glyc_Psyn

?
TIGR02398: gluc_glyc_Psyn 
glucosylglycerol-phosphate synthase
Glucosylglycerol-phosphate synthase catalyzes the key step in the biosynthesis of the osmolyte glucosylglycerol. It is known in several cyanobacteria and in Pseudomonas anguilliseptica. The enzyme is closely related to the alpha,alpha-trehalose-phosphate synthase, likewise involved in osmolyte biosynthesis, of E. coli and many other bacteria. A close homolog from Xanthomonas campestris is excluded from this model and scores between trusted and noise.
Statistics
?
PSSM-Id: 131451
View PSSM: TIGR02398
Aligned: 3 rows
Threshold Bit Score: 902.726
Threshold Setting Gi: 190358887
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q93JY3   257 VYHRLPYEEFRGAdGKLQRRRPTSPNGIIPTLLSFFGDGRAGSWVAWAEHD-ENSGETFDSHTTVDAErYpKLTAARVAL 335 Pseudomonas anguill...
O65979     8 LYHREPYDEVREN-GKTFYRDKTSPNGIMPTLKSFFANAEQSTWVAWKQIS-GKQQENFQAKMAFPGQ-E-NSVVHRIPL 83  Synechococcus sp. P...
CAE07796   9 LYHRTPFDEAKDAqGNQVWVDQKSPNGIIPTLRNLFRSRNDGTWIAWRHVDhPEEMDVERLEMTNPSP----FALCRIPL 84  Synechococcus sp. W...
Q93JY3   336 SKEEVDIFYKRFSKEAFWPTLHTFWERGQFREDDWQVFLKVNRAFAERTALEAAEGATVWLHDYNLWMVPGYLRELRPDL 415 Pseudomonas anguill...
O65979    84 SADQVKNFYHITSKEAFWPILHSFPWQFTYDSSDWENFKQINEMFAEAACEDADDDALFWVHDYNLWLTPYFIRQKKPNA 163 Synechococcus sp. P...
CAE07796  85 ADEQISSFYHITSKECFWPILHTFPTHFNVNNANWGIFEEVNKRFADAACNEAAEGATVWVHDYNLWLAPGYIRQQRPDL 164 Synechococcus sp. W...
Q93JY3   416 RIAFFHHTYFPSADVFNVLPWRRQIIGSLLQCDYIGFHIPRQVENFVDAARGVMPLQTVSRQNCAP-RFITYGCAVGLER 494 Pseudomonas anguill...
O65979   164 KIAFFHHTPFPSVDIFNILPWREAIVDSLLCCDLCGFHLPRYVQNFVAVARSLRKVEITRQVPVDEhAFTAVGTALAEPE 243 Synechococcus sp. P...
CAE07796 165 KIAFFHHTPFPGNDVFAILPWREQILESLLCCDVVGFHIPRYTENFARAASTLVGAKRGPKISVDQ-KFISVGTALSEGT 243 Synechococcus sp. W...
Q93JY3   495 MTTAVDTGNRVVKLGAHPVGLDIERVRSALAAPKIREMMERLRSELA-GVKLILSVERLDYTKGILEKLNAYERLLEENP 573 Pseudomonas anguill...
O65979   244 ITTQLKYKDHLVNLDAFPVGTNPTQIRAQVEKASTQERIRKIREELG-SNKLILSAGRVDYVKGTKEMLVCYERLLERRP 322 Synechococcus sp. P...
CAE07796 244 VTSHLDHNGRRIQLLSSPVGTSPDVIQELSWSASVESYGEMIVQDTKkGRKLILSASRVDYTKGNEELLLAFERLLERRE 323 Synechococcus sp. W...
Q93JY3   574 ELLGKVTLVTVCVPAAKEMTIYDELQGQIEQAVGRINGRFARIGWTPLQFFFRSLPFEEVSAWYAMADVMWITPLRDGLN 653 Pseudomonas anguill...
O65979   323 ELQTKVNLVVAAAKAASGMRVYKNAQSEIERLVGRINGRFAKLNWTPILLFTSALSYEELLGFFGAADIAWITPLRDGLN 402 Synechococcus sp. P...
CAE07796 324 DLHGEVVLMLACVAAASGMKIYEETQRSIEEMAGRINGRFSQVDWIPVRFSTRRIPYEEMVAWFCHADVCWITPLRDGLN 403 Synechococcus sp. W...
Q93JY3   654 LVAKEFVAAQGLLDGrgVLVLSEFAGAAAELKGALLTNPHDPVDMTQTCYVALNMPKAEAQARLRELFDIVNYNDIRRWG 733 Pseudomonas anguill...
O65979   403 LVAKEYVVAHGCDDG--VLILSEFAGSAVELPDAILTNPYAAKRMDESIDQALAMPVEEQQRRMKSMYQAIQRYDVQQWA 480 Synechococcus sp. P...
CAE07796 404 LVAKEYAAARRHRGG--VLVLSEFTGASVVLEGAVLTNPYSNRRMDEAIEAALAMPEHEQRQRMETMSAAVEAYTVQDWA 481 Synechococcus sp. W...
Q93JY3   734 DEFLAAVSdPQEQLD 748 Pseudomonas anguilliseptica
O65979   481 NHMFREAK-ATAVLG 494 Synechococcus sp. PCC 7002
CAE07796 482 EEQLAGFP-EVATIG 495 Synechococcus sp. WH 8102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap