Conserved Protein Domain Family
rpoS_proteo

?
TIGR02394: rpoS_proteo 
RNA polymerase sigma factor RpoS
A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoS (also called sigma-38, KatF, etc.), found only in Proteobacteria. This sigma factor is induced in stationary phase (in response to the stress of nutrient limitation) and becomes the second prinicipal sigma factor at that time. RpoS is a member of the larger Sigma-70 subfamily (TIGR02937) and most closely related to RpoD (TIGR02393). [Cellular processes, Adaptations to atypical conditions, Transcription, Transcription factors]
Statistics
?
PSSM-Id: 131447
View PSSM: TIGR02394
Aligned: 7 rows
Threshold Bit Score: 459.191
Threshold Setting Gi: 504242431
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO34104      67 DFRALLQAELTADTIQHYLNRISVKPLLTVEEEQRYSRLAKAGEFEARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEG 146 Burkholderia ps...
P13445        44 ELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEG 123 Escherichia col...
AAD51396      57 SFQRGKNIAKALDATQLYLGEIGFSPLLTAEEEIHYATLALKGDMEARKKMIESNLRLVVKIARRYLNRGLPLLDLIEEG 136 Legionella pneu...
AAF61172      67 AKTKKRRETRSSDPTQIYLRELGFQPLLNAKEELKIARRVHKGDPKARKQMIEANLRLVVKIARHYVNRGLPFLDLIEEG 146 Coxiella burnetii
AAQ61344      32 SESTAVFEDVVADVTQIYLNDIGNNALLTPQEELALARRVVAGEFEARQKMIEHNLRLVVNIAKHYINRGLALLDLIEEG 111 Chromobacterium...
CAG22832       2 EIKKAETQTFDADVIQLYLREIALKPLLTKHEEILYSRKSLTGDKEAKKVMIESNLRLVVSIAKKYRGSGMQLSDLIDEG 81  Photobacterium ...
WP_014429533  34 AQVPADGEGEHGNTLQSYLRDIRRAPLMSAEEEHATAVRARAGDFAARQAMIERNLRLVVSIAKHYVGRGMPMIDLIEEG 113 Rubrivivax gela...
AAO34104     147 NLGLMHAIEKFDPTRGFRFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKnsmSTGeaaerREASI 226 Burkholderia ps...
P13445       124 NLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSH---KLD-----HEPSA 195 Escherichia col...
AAD51396     137 NLGLMKSVEKFDPKRGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARQLTQ---KLD-----HEPSP 208 Legionella pneu...
AAF61172     147 NLGLLTAVEKFDPERGFRFSTYATWWIRQTIERAIMNQSRTVRLPIHVIKELNVYLRTAKKLTQ---EVD-----HEATP 218 Coxiella burnetii
AAQ61344     112 NIGLMHALEKFDPERGFRFSTYATWWIRQSIERAIMNQSRTIRLPVHVIKELNVYLRASRHLES---QIG-----REPSV 183 Chromobacterium...
CAG22832      82 NIGLITSVEKFDPERGFRFSTYATWWIKQTIERCIHNQARTIRLPVHVSKEINTIIRTHKQLMK---KNN-----QEPTR 153 Photobacterium ...
WP_014429533 114 NLGLMHATGKFEPERGFRFSTYASWWIRQSIERAIMHQARLIRLPVHVVRELNQVLKARRALESa--RRGea--eRPVSV 189 Rubrivivax gela...
AAO34104     227 DDIAYLTGKTAEEVTDILALNEHTASLDAPLDLDP-ASSLLDLLPDDQSQSPDAEVQHRELETLTRAWLSRLSDKHRHVI 305 Burkholderia ps...
P13445       196 EEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDS-EKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVL 274 Escherichia col...
AAD51396     209 EEIAEMVDKPLEDVQKLLGLNDKVASVDTPIGFDE-TKSLLDTIADENSLNPAELLTNENLRQHIESLLDKLTENQQQVI 287 Legionella pneu...
AAF61172     219 EDVAHLIDKPVQEIRRIMDLAPSATSIDVPISEDG-QKSLVDTLADDNNIDPARLIQNVDLQDHIERWLAQLDERHREVV 297 Coxiella burnetii
AAQ61344     184 EEIAHLVGKPVEDVRKVLNLNERMASLDAPLDIDP-MLSIGESIPDEQHEEPELQLHNSQLEMFVHDWLSQLNEKQRLVI 262 Chromobacterium...
CAG22832     154 EEVAEKLERSVDDISSVLAYDAPIVSFDQTINDDAnSQSISVFIADDSSDKPESQVDKDDIKGLALAMLENLNQRDREIL 233 Photobacterium ...
WP_014429533 190 DEVAAALQRPVEEVAELLKLAEQPTSLDMPLERES-GESMLDTVADEDAIDPLGLTLSREAVHLLDNGLAELNEREREVL 268 Rubrivivax gela...
AAO34104     306 ERRFGLNHIEPATLEELADEMGLTRERVRQIQQEALVRLKRFFASNGVRKDAVL 359 Burkholderia pseudomallei
P13445       275 ARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALF 328 Escherichia coli K-12
AAD51396     288 ARRFGLRGFEKATLEDVGKEIDLTRERVRQIQVEALKTLRTLLERVGLTQEDLF 341 Legionella pneumophila
AAF61172     298 ILRFGLHENEKGTLEAVGKAVGLTRERVRQIQIDALQQLRHILEMEGVTGEEVE 351 Coxiella burnetii
AAQ61344     263 ERRYGLNGYEICTLEELAASLNLTRERVRQIQIEGLEQLRRILRRKGISRDFLL 316 Chromobacterium violaceum ATCC 12472
CAG22832     234 CRRFGLLGYEVQTLQQVANEVGLTRERIRQLQVSSLKKLKNTLERDNYDLELLF 287 Photobacterium profundum SS9
WP_014429533 269 AGRFGLRDREPETLEELAARLGLTRERIRQIQQEALLKLKRRMVRRGVDRDALF 322 Rubrivivax gelatinosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap