Conserved Protein Domain Family
hypoth_ymh

?
TIGR02391: hypoth_ymh 
TIGR02391 family protein
This family consists of a relatively rare (~ 8 occurrences per 200 genomes) prokaryotic protein family. Genes for members are appear to be associated variously with phage and plasmid regions, restriction system loci, transposons, and housekeeping genes. The function is unknown. [Hypothetical proteins, Domain]
Statistics
?
PSSM-Id: 162834
View PSSM: TIGR02391
Aligned: 6 rows
Threshold Bit Score: 147.208
Threshold Setting Gi: 501942740
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB91582     139 VHPDVLRFCREELLVDN-YFHAVLEAVKSVADKIRQRTG-L-TDDGAVLVDRAFS-GDaPMLAIN--ELQSESEKGEQRG 212 Agrobacterium t...
AAK33861     138 VHPHVLKFCTQELLQEN-YFHAVFEASKGVFHRIRLLTG-S-AMDSASLIDQCFK-PGePIVIINgnKLQTLDEQSEYKG 213 Streptococcus p...
CAC36703     118 LHPALEGPVRTNFHLGE-YELASFAAMKAVEVAVREASGlDnSLVGVHLMRAAFQpHKnGKVGGP--LADAEAEGGEQEA 194 Streptomyces co...
WP_011169261 364 LNEKIRERIKVYYENKQ-YGEAADQSVKIYCEYIRELTG-F-AEDGVELTGKVFSsKNkPFFEVG--DISTVTGINLQSG 438 Pseudomonas sav...
WP_029682825 158 LHQDLHTACNDFYNEKKdYLSAAIEAVKVFEDKVQKQTGlH-SIDGRELIEQAFGsKN-SILLLT--NNKTKAEQNLEDG 233 Neisseria menin...
WP_012676723 138 lnnKVFAHVKELLADGH-YFHAVEESFKIVREKLREITG-------KERATEAFReQNyEKIFGH--SPQNETERDFFEG 207 Persephonella m...
AAB91582     213 FSNLVKGTFSMFRNTTAHAPRIHWQMSKEDAEDLFSMFSLMHRRIDAAIM 262 Agrobacterium tumefaciens
AAK33861     214 LKNLLLAIAHLYRNSKAHKLKYYNPDNLNDALTALTLMSLAHNLLDSCSN 263 Streptococcus pyogenes M1 GAS
CAC36703     195 ASALFAGAMGAYKNPPSHRTVKFDDP--IEAAEIIQFADLLLRQVDRAKQ 242 Streptomyces coelicolor A3(2)
WP_011169261 439 QDFFSRGLITGFRNPVAHAPLDAIIPKIFTEMDCLNVLSLTSYLLERLDR 488 Pseudomonas savastanoi
WP_029682825 234 LEQLACGTWTGFRNPVQHELRANLSPSIFNDKDALDLISLVSYLLRKVEQ 283 Neisseria meningitidis
WP_012676723 208 -VKFLHMAIQFFRNEKVHTPAYKIDKNL--AIHYIVLASLAYELIDRGKN 254 Persephonella marina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap