2FS5


Conserved Protein Domain Family
wecD_rffC

?
TIGR02382: wecD_rffC 
Click on image for an interactive view with Cn3D
TDP-D-fucosamine acetyltransferase
This model represents the WecD protein (Formerly RffC) for the biosynthesis of enterobacterial common antigen (ECA), an outer leaflet, outer membrane glycolipid with a trisaccharide repeat unit. WecD is a member of the GNAT family of acetytransferases (pfam00583). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131435
View PSSM: TIGR02382
Aligned: 4 rows
Threshold Bit Score: 313.831
Threshold Setting Gi: 152031664
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FS5_A    55 VQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNN-----V----SDS-----GAVVAQETDIPALRQLASAAFAQSRF 120 Escherichia coli CF...
CAG77102  53 TQAKIAADNLVLADALADLGFRLVEGEVDLSLPLHP-----TtvvtPLP-----RWREATLDDIPALRDAASRVFALSRF 122 Pectobacterium atro...
P27832    44 VQAKIAASNTGELDALQQLGFSLVEGEVDLALPVNNa---------SDS-----GAVVAQETDIPALRQLASAAFAQSRF 109 Escherichia coli K-12
AAS63353  63 VQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEkegigTenatSEPnmgaySLRVATEADIPQLRRVAASAFALSRF 142 Yersinia pestis bio...
2FS5_A   121 RAPWYAPDASGRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAG------RGAGAELMQTALN 194 Escherichia coli CF...
CAG77102 123 RTPWYQPEDSGRFYAQWVENAVCGTFDHSCLMMEDAAGHPQGWVTLRRLDDSDARIGLLGVwpgvtiRGIGSQLMALAEA 202 Pectobacterium atro...
P27832   110 RAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAG------RGAGAELMQTALN 183 Escherichia coli K-12
AAS63353 143 RAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVLDPTDQPVGFVTLRDLQDGSARIGLLAVfpgaqsKGIGLRLMSAAKQ 222 Yersinia pestis bio...
2FS5_A   195 WAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR 235 Escherichia coli CFT073
CAG77102 203 WCRQQGLIRLRVATQVGNVAALRLYLRRGATIESTAYWLYR 243 Pectobacterium atrosepticum SCRI1043
P27832   184 WAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR 224 Escherichia coli K-12
AAS63353 223 WCQHHGLHRLRVATQMSNIAALRLYIRSGASIESTAYWLCR 263 Yersinia pestis biovar Microtus str. 91001
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap