Conserved Protein Domain Family
cspD

?
TIGR02381: cspD 
cold shock domain protein CspD
This model represents what appears to be a phylogenetically distinct clade, containing E. coli CspD (SP|P24245) and related proteobacterial proteins within the larger family of cold shock domain proteins described by pfam00313. The gene symbol cspD may have been used idependently for other subfamilies of cold shock domain proteins, such as for B. subtilis CspD. These proteins typically are shorter than 70 amino acids. In E. coli, CspD is a stress response protein induced in stationary phase. This homodimer binds single-stranded DNA and appears to inhibit DNA replication. [DNA metabolism, DNA replication, recombination, and repair, Cellular processes, Adaptations to atypical conditions]
Statistics
?
PSSM-Id: 131434
View PSSM: TIGR02381
Aligned: 5 rows
Threshold Bit Score: 128.043
Threshold Setting Gi: 24985709
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P24245    1 MEKGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVQFDVHQGPKGNHASVIVPVE 68  Escherichia coli
Q9KSW4    4 MATGTVKWFNNAKGFGFICPEGEDGDIFAHYSTIQMDGYRTLKAGQQVSYQVEQGPKGYHASCVVPIE 71  Vibrio cholerae O1 biovar El Tor...
AAN69604  1 MASGKVKWFNNAKGYGFINEEGKSDDLFAHYSAIQMDGYKTLKAGQAVVFNIVQGPKGLHAVEIKDAA 68  Pseudomonas putida KT2440
P46449    1 MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSHATKIIPIA 68  Haemophilus influenzae Rd KW20
AAP96179  1 MHIGIVKWFNNVKGFGFITCDTVEGDIFAHFSEIKQDGYRSLKVGQKVQFELVTNERGASATHISTIE 68  Haemophilus ducreyi 35000HP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap