Conserved Protein Domain Family
ECA_wecA

?
TIGR02380: ECA_wecA 
undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase
Members of this family are the WecA enzyme of enterobacterial common antigen biosynthesis, undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase. This family represents one narrow clade, and closely related sequences outside this clade may represent enzymes that catalyze the same specific reaction, but in the context of different pathways. A His-rich motif in a cytosolic loop of this integral membrane protein, shown critical to enzymatic activity for WecA is variously present or absent in the clade that includes Bacillus subtilis TagO teichoic acid biosynthesis enzyme, which may catalyze the same reaction as WecA. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131433
View PSSM: TIGR02380
Aligned: 6 rows
Threshold Bit Score: 487.666
Threshold Setting Gi: 46914261
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG21051   2 INAFIFVFITSFCSLFVFRKVAKYVGLVDKPNARKHHQGVVPLVGGVSIFFT-LAITFLLFTTIDSGLVLFLICATILVV 80  Photobacterium prof...
CAG21041   3 FIELIVIFLLSFIFIFTLRRIAIIVDLVDKPSLRKSHCGFIPLVGGISIFLT-LSMVLFSHPALIIKYNVFLFCSSILVL 81  Photobacterium prof...
AAO32663   2 FLELSFIFFSSFATLFLMRKVAKRIGLVDKPNARKLHTGSVPLVGGISICLV-LAQYLVFRPETINHSWLYLASIVLLTF 80  Vibrio vulnificus
P24235     7 STDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQGLIPLVGGISVYAG-ICFTFGIVDYYIPHASLYLACAGVLVF 85  Escherichia coli
P45341     1 MLSIFVTFLGAFLTLIVMRPLANWIGLVDKPNYRKRHQGTIPLIGGASLFVGnLCYYLMEWD-QLRLPYLYLFSIFVLLA 79  Haemophilus influen...
CAG74326  15 MQDFIVVFLSAFAALFLARKVATIIGLVDKPCARKKHRGNIPLVGGVSIYCA-LCILFILHSDWLPDFSLYMVCATLLLV 93  Pectobacterium atro...
CAG21051  81 MGVIDDRYDISFKIRLVIQAGVSLAMILIGDKSLHSLGYLMGSEAIELSpIASAMITIFAVIGAINAFNMVDGIDGLLGG 160 Photobacterium prof...
CAG21041  82 TGIIDDKNNIQVNIRLAIQILVSIVAIQFGNISIHNLGAIFSPKELTLApLLSNIITILAIVGAMNAFNMIDGIDGLLGG 161 Photobacterium prof...
AAO32663  81 VGALDDKFDLSFKIRMGIQAALSLVMMHAAGIELHSLGNLFGVGEIYLG-WVGSIITIFAVIGAINAFNMVDGIDGLLGG 159 Vibrio vulnificus
P24235    86 IGALDDRFDISVKIRATIQAAVGIVMMVFGKLYLSSLGYIFGSWEMVLG-PFGYFLTLFAVWAAINAFNMVDGIDGLLGG 164 Escherichia coli
P45341    80 IGILDDRFDISPFLRAGIQAILAILMIDLGNIYLDHLGQILGPFQLTLG-SIGLIITVFATIAIINAFNMIDGIDGLLGG 158 Haemophilus influen...
CAG74326  94 IGVIDDRFDLPVLPRFAVQTMVGGLMMYSG-LYLSSLGNVLFGHELLLG-GFGYVITLFAVCGAINAFNMIDGIDGLLGS 171 Pectobacterium atro...
CAG21051 161 LASVTFGALGYLFLIDGNIELAMVCGLLVTAMIPYILLNLGFPLGRRFKVFMGDAGSIFIGFTVIWLLIEATQGVNSTPI 240 Photobacterium prof...
CAG21041 162 VAIVVFSALGYLFWLNSNVELYYFCSIVIIAVIPYLILNLEFIFGKNLKVFMGDAGSLFIGFTVVWLLLNGTQANSSPSF 241 Photobacterium prof...
AAO32663 160 LSIVTFGALAFLLNVDSQHGLAYLCVVIIVAMLPYILMNLG-ILGRKRKVFMGDAGSMMIGFTVIWLLLGVSQVESKPLM 238 Vibrio vulnificus
P24235   165 LSCVSFAAIGMILWFDGQTSLAIWCFAMIAAILPYIMLNLGI-LGRRYKVFMGDAGSTLIGFTVIWILLETTQGKTHP-I 242 Escherichia coli
P45341   159 LSCVSFAAIGILMYRDGQMDMAHWSFALIVSILPYLMLNLGIPFGPKYKVFMGDAGSTLIGFTIIWILLLSTQGKGHP-M 237 Haemophilus influen...
CAG74326 172 LSCIAFCSLFFLFYSGGERQLGLWSLCMMAATLPYLFLNLGIPLGKKFKVFMGDAGSTVIGFTVLWLLVLASQGETAV-M 250 Pectobacterium atro...
CAG21051 241 RPVTALWVIALPLMDMATIMVRRIRKGQSPFKPDREHLHHICQRIGLSSHMSLFVICLCASIMASIGIWSDV-AQINETV 319 Photobacterium prof...
CAG21041 242 KPVTALWLIAFPLMDMATIILNRIQNGRSPFQPDKQHLHHKLQVLGLPNRLILFILCGFSAIFAYIGIWSEI-NDVSEVV 320 Photobacterium prof...
AAO32663 239 RPVTALWLIAVPLMDMAAIMIRRVRRGDSPFKPDREHLHHIFQRLGLTSRQTLVVICGFATLFAAFGIYGEA-ANLSEAF 317 Vibrio vulnificus
P24235   243 SPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLIMRAGFTSRQAFVLITLAAALLASIGVLAEYsHFVPEWV 322 Escherichia coli
P45341   238 NPVTALWIIAIPLIDMVAIIYRRVRKGKSPFRPDRLHVHHLMVRAGLTSRQAFLLITFVSAVCATIGILGEV-YYVNEWA 316 Haemophilus influen...
CAG74326 251 HPVTALWLIALPLIDMIAIMLRRFLRGDSPFKADRGHLHHILMSSGLTSRQSLMVITFAALLLAAVGIISDR-NNVSQSM 329 Pectobacterium atro...
CAG21051 320 MFVSFLAVFAVYFWVISHIWKITTWVHKL 348 Photobacterium profundum SS9
CAG21041 321 MLFSFSSLFVVYFILVSHLSVFFARLHSF 349 Photobacterium profundum SS9
AAO32663 318 MFYSFIACFLVYATLLNYVWRITSLSAAA 346 Vibrio vulnificus
P24235   323 MLVLFLLAFFLYGYCIKRAWKVARFIKRV 351 Escherichia coli
P45341   317 MFVGFFILFFLYVYSITHAWRITRWVRRM 345 Haemophilus influenzae Rd KW20
CAG74326 330 MLSLFFVTFIGYFYFIPRIGKVLQLGRRT 358 Pectobacterium atrosepticum SCRI1043
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap