4WFP


Conserved Protein Domain Family
ECA_wecE

?
TIGR02379: ECA_wecE 
TDP-4-keto-6-deoxy-D-glucose transaminase
This family consists of TDP-4-keto-6-deoxy-D-glucose transaminases, the WecE (formerly RffA) protein of enterobacterial common antigen (ECA) biosynthesis, from enterobacteria. It also includes closely matching sequence from species not expected to make ECA, but which contain other genes for the biosynthesis of TDP-4-keto-6-deoxy-D-Glc, an intermediate in the biosynthesis of other compounds as well and the substrate of WecA. This family belongs to the DegT/DnrJ/EryC1/StrS aminotransferase family (pfam01041). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 131432
View PSSM: TIGR02379
Aligned: 6 rows
Threshold Bit Score: 733.935
Threshold Setting Gi: 30139208
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WFP_A        21 MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYT 100 Escherichia col...
BAC93069       7 MIPFNKPPVTGEELQFIQEAISCGKLSGDGEFSRKCENWFVSHTGTTKALLTPSCTHALEMAAMLIDIQPGDEVIMPSYT 86  Vibrio vulnific...
CAD86078       7 RIPFNWPHMTGKELYYIAEAHFNGSLAGDGPFTKRCHAWLEERTGCNKGLLTHSCTAALEMAALLLDIQPGDEVIMPSYT 86  Nitrosomonas eu...
P27833         1 MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYT 80  Escherichia col...
WP_011066807   1 MIPFNIPCHLGQEEEAIAEAIKEQKLSGNGRFSRYCTTWLENQLDAKKAILTPSCTAALEMSAILTDVSEGDEVIMPSYT 80  Oceanobacillus ...
AAL77369       3 FIPFNKPPVTGNELKYISQAVSGDKLSGDGPFAKQCEVWLEKHTQTKKALLTPSCTHALELAALLIDIQAGDEVIMPSFT 82  Vibrio cholerae
4WFP_A       101 FVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMST 180 Escherichia col...
BAC93069      87 FVSTANAFVLRGAKVVFVDIRADTMNIDESKIEVAITERTKAIVPVHYAGVACDMDTIMGLSDKYGLYVIEDAAQGMMST 166 Vibrio vulnific...
CAD86078      87 FVSTANAFVLRGGVPVFVDIREDTLNLDERLIESAITPRTRAIAPVHYAGVACEMDTIMAIAQKHELKVVEDAAQGVMST 166 Nitrosomonas eu...
P27833        81 FVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMST 160 Escherichia col...
WP_011066807  81 FVSTANAFALRGAHIRFVDVEPTTMNIDPKAIEAAINHRTKAIVVVHYGGVACDMIPIMNLANEHQLWVIEDAAQGLKSQ 160 Oceanobacillus ...
AAL77369      83 FVSTANAFVLRGAKIVFVDIRPDTMNIDETKIESAITARTKAIVPVHYAGVSCDMGTIMAIANKYKLFVIEDAAQGMMST 162 Vibrio cholerae
4WFP_A       181 YKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQA 260 Escherichia col...
BAC93069     167 YKGRALGSIGHIGTYSFHETKNYTSGGEGGLLLVNDQSFSQRAEIIREKGTNRNQFFRGMVDKYTWVDVGSSMLPSEIQS 246 Vibrio vulnific...
CAD86078     167 YKGRALGSIGDLGAYSFHETKNVISG-EGGALLVNTPDLSLRAEIIREKGTDRSQFFRGEVDKYTWQEVGSSFLPGELIA 245 Nitrosomonas eu...
P27833       161 YKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQA 240 Escherichia col...
WP_011066807 161 YNGRPLGTIGHLGTFSFHETKNYTCG-EGGALIINDDAFIERAEIIQEKGTDRSKFVRGEVDKYTWRDIGSSYLTSELNA 239 Oceanobacillus ...
AAL77369     163 YKDQPLGSIGHMAAFSFHETKNYTSGGEGGALLINDQRFIQRAEILREKGTNRSLFFKGMVDKYTWVDIGSSMLPSEIQA 242 Vibrio cholerae
4WFP_A       261 AYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFH 340 Escherichia col...
BAC93069     247 AYLWAQLINAKRINEKRINDWNYYFDSLLPLKEKGLIELPNIPIECTHNAHMFYIKLPDLTQRTRFIEAMFKQGVLSVFH 326 Vibrio vulnific...
CAD86078     246 AFLWAQLEEADRITNERLASWQRYHELLGPLEAKEILRRPIVPEECQHNAHMYYVLLASKIDRQEVLDEFKRNDIWSVFH 325 Nitrosomonas eu...
P27833       241 AYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFH 320 Escherichia col...
WP_011066807 240 AYLSVQLDQAEVINQDRLATWYLYQKGLKPLEEKGILDLPTIPNGYKHNAHMFYIKTKTEEDRNELIKYLKEQEIMAVTH 319 Oceanobacillus ...
AAL77369     243 AYLYAQMEQAVEINHTRLNIWNSYLNAFSKYQESGVIELPSIPANCQHNAHMFYIKLHNVDIRDKFIIHMKNNSVLTVFH 322 Vibrio cholerae
4WFP_A       341 YIPLHGCPAGEHFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS 396 Escherichia coli K-12
BAC93069     327 YIPLHSSPAGKSFGRFNGKDIYTTMESEKLVRLPMFYGLALSERNKIISTIFDILE 382 Vibrio vulnificus YJ016
CAD86078     326 YVPLHSSPAGLRYGRIHGNLKITTQQSERLVRLPLWVGLSVEQQDRVVEVLCKAVS 381 Nitrosomonas europaea ATCC 19718
P27833       321 YIPLHGCPAGEHFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS 376 Escherichia coli K-12
WP_011066807 320 YVPLHQSEAGRYYGSFSGEDMYTTSHSNRILRLPLYYGITKRDVAYVIQTIQQYYS 375 Oceanobacillus iheyensis
AAL77369     323 YLPLHSTVAGRKFSYFHGEDIHTTKESEKLVRLPLYFNLKEEDMYRIIDIACDFLD 378 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap