Conserved Protein Domain Family
MocE_fam_FeS

?
TIGR02377: MocE_fam_FeS 
Rieske [2Fe-2S] domain protein, MocE subfamily
This model describes a subfamily of the Rieske-like [2Fe-2S] family of ferredoxins that includes MocE, part of the rhizopine (3-O-methyl-scyllo-inosamine) catabolic cluster in Rhizobium. Members of this family are related to, yet distinct from, the small subunit of nitrite reductase [NAD(P)H].
Statistics
?
PSSM-Id: 131430
View PSSM: TIGR02377
Aligned: 3 rows
Threshold Bit Score: 185.843
Threshold Setting Gi: 15075551
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB51527       3 DWVEACATDDIDEEDVMRFDHGGRTFAIYRSPDDEYFATDGLCTHEKVHLADGLVMDDIIECPKHNGRFNYKTGAARGAP 82  Mesorhizobium l...
CAC47106       6 NWVKACDAKKVGREDVARWDHSGRSFAIFRTADDQYYATDDICTHEYAHISDGFVEGTTVECPRHAGCFDFRTGEALNPP 85  Sinorhizobium m...
WP_010968075   2 TWVSACKLDDIEQEGAIRFDHGGRTYAIYRGPDDSVYCTAGLCTHEAIHLADGLVMDFEVECPKHSGAFDYRTGEAIRLP 81  Sinorhizobium m...
BAB51527      83 VCVNLKTYPVKVDAGKVLVQV 103 Mesorhizobium loti MAFF303099
CAC47106      86 VCVNLRTFPVKVVDGAVYIDI 106 Sinorhizobium meliloti 1021
WP_010968075  82 ACENLKTYPAEVVDGEVRVAL 102 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap