1NIB,2DWT,1KBW,1NDR


Conserved Protein Domain Family
Cu_nitrite_red

?
TIGR02376: Cu_nitrite_red 
Click on image for an interactive view with Cn3D
nitrite reductase, copper-containing
This family consists of copper-type nitrite reductase. It reduces nitrite to nitric oxide, the first step in denitrification. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 131429
View PSSM: TIGR02376
Aligned: 11 rows
Threshold Bit Score: 472.73
Threshold Setting Gi: 17942998
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NIB_A    12 LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDrE-GTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDT 90  Achromobacter cyclo...
P25006    50 LPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDrE-GTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDT 128 Achromobacter cyclo...
Q06006    30 LQRVKVDLVAPPLVHPHEQVVSGPPKVVQFRMSIEEKKMVIDdQ-GTTLQAMTFNGSMPGPTLVVHEGDYIELTLVNPAT 108 Pseudomonas chloror...
Q53239    44 LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLD-E-DAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPE 121 Rhodobacter sphaero...
CAD89521  45 GSADLVDQVAADPTDIPGPIDRSEPAEVDVTLRPEEVTAEVE-D-GVTFTYTTYNGQVPGPLVRVRQGDTVNLTFENPEE 122 Haloferax denitrifi...
CAB93142  51 AQQTDVDRIAADPTAIPDPIDRSEPKTVSVEMTTKEQVAEIE-P-GVTYTYMTFGDQIPGPMIRVRRGDTVELTITNEEG 128 Haloarcula marismortui
Q02219    52 GELPVIDAVTTHAPEVPPAIDRDYPAKVRVKMETVEKTMKMD-D-GVEYRYWTFDGDVPGRMIRVREGDTVEVEFSNNPS 129 Neisseria gonorrhoeae
Q60214    49 LPRRKLDLVKPPFVHVHTQKAEGGPKVVEVTLTIEEKKLVIDgK-GTEVNAMTFDGSVPGPLIVVHQDDYVEVTLVNPET 127 Rhizobium sullae
2DWT_A     1 LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLD-E-DAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPE 78  Rhodobacter sphaero...
1KBW_A    12 GELPVIDAVTTHAPEVPPAIDRDYPAKVRVKMETVEKTMKMD-D-GVEYRYWTFDGDVPGRMIRVREGDTVEVEFSNNPS 89  Neisseria gonorrhoeae
1NDR_A     2 LPRVAVDLVAPPLVHPHSQVAAGAPKVVQFRMSIEEKKMVAD-DdGTTAQAMTFNGSVPGPTLVVHEGDYIELTLVNPAT 80  Achromobacter xylos...
1NIB_A    91 NTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGm-VPWHVTSGMNGAIMVLPRDGLKdekgqp 169 Achromobacter cyclo...
P25006   129 NTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGm-VPWHVTSGMNGAIMVLPRDGLKdekgqp 207 Achromobacter cyclo...
Q06006   109 NSMPHNVDFHAATGALGGAGLTQVVPGQEVVLRFKADRSGTFVYHCAPQGm-VPWHVVSGMNGALMVLPRDGLRdpqgkl 187 Pseudomonas chloror...
Q53239   122 NTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGpmIPWHVVSGMAGCIMVLPRDGLKdhegkp 201 Rhodobacter sphaero...
CAD89521 123 NTMPHNVDFHAVAGPGGGAEATMTNPGETAHLRFKATYPGAYIYHCAVPN--MDMHISAGMFGLILVEPPEGLP------ 194 Haloferax denitrifi...
CAB93142 129 NSMPHNIDLHAVRGPGGGAEASMVTPGQTKTFRFKATYPGAFIYHCAVPN--LDMHISSGMFGMILVEPKEGLP------ 200 Haloarcula marismortui
Q02219   130 STVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAP--VGMHIANGMYGLILVEPKEGLP------ 201 Neisseria gonorrhoeae
Q60214   128 NTLQHNIDFHSATGALGGGALTVVNPGESAVLRFKATKAGVFVYHCAPPGm-VPWHVTSGMNGAIMVLPREGLTdghgke 206 Rhizobium sullae
2DWT_A    79 NTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGpmIPWHVVSGMAGCIMVLPRDGLKdhegkp 158 Rhodobacter sphaero...
1KBW_A    90 STVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAP--VGMHIANGMYGLILVEPKEGLP------ 161 Neisseria gonorrhoeae
1NDR_A    81 NSMPHNVDFHAATGALGGAGLTQVVPGQEAVLRFKADRSGTFVYHCAPAGm-VPWHVVSGMNGALMVLPRDGLR------ 153 Achromobacter xylos...
1NIB_A   170 lT-------YDKIYYVGEQDFYVPKDE--------AgnykkyetP--------GEAYEDAVKAMRTLTPTHIVFNGAVGA 226 Achromobacter cyclo...
P25006   208 lT-------YDKIYYVGEQDFYVPKDE--------Agny--kkyEt------pGEAYEDAVKAMRTLTPTHIVFNGAVGA 264 Achromobacter cyclo...
Q06006   188 lH-------YDRVYTIGESDLYIPKDK--------Dghy--kdyPd------lASSYQDTRAVMRTLTPSHVVFNGRVGA 244 Pseudomonas chloror...
Q53239   202 vR-------YDTVYYIGESDHYIPKDE--------Dgty--mrfSd------pSEGYEDMVAVMDTLIPSHIVFNGAVGA 258 Rhodobacter sphaero...
CAD89521 195 -E-------VDHEIYLGQHELYTDKDA--------G--------E--------EGQHTFDYEAMRNEDPTYVLMNGEKYA 242 Haloferax denitrifi...
CAB93142 201 -E-------VDHEFYFGQHELYTTGDT--------G--------E--------KGHHDFDMEAMAAEEPTYVLMNGEKYA 248 Haloarcula marismortui
Q02219   202 -K-------VDKEFYIVQGDFYTKGKK--------G--------A--------QGLQPFDMDKAVAEQPEYVVFNGHVGS 249 Neisseria gonorrhoeae
Q60214   207 lV-------YDKVYYLGEQDFYIPRDE--------Kgef--kkyDs------pGEAYEDTVAVMRTLTPTHIVFNGAVGA 263 Rhizobium sullae
2DWT_A   159 vR-------YDTVYYIGESDHYIPKDEdgtymrfsD--------P--------SEGYEDMVAVMDTLIPSHIVFNGAVGA 215 Rhodobacter sphaero...
1KBW_A   162 -K-------VDKEFYIVQGDFYTKGKK--------G--------A--------QGLQPFDMDKAVAEQPEYVVFNGHVGA 209 Neisseria gonorrhoeae
1NDR_A   154 -DaagaalaYDRVYTIGESDLYVPKAA--------D--------GnysdypalASAYADTVAVMRTLTPSHAVFNGAVGA 216 Achromobacter xylos...
1NIB_A   227 LTGDH-----ALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVY 301 Achromobacter cyclo...
P25006   265 LTGDH-----ALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVY 339 Achromobacter cyclo...
Q06006   245 LTGAN-----ALTSKVGESVLFIHSQANRDSRPHLIGGHGDWVWTTGKFANPPQRNMETWFIPGGSAVAALYTFKQPGTY 319 Pseudomonas chloror...
Q53239   259 LTGEG-----ALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVY 333 Rhodobacter sphaero...
CAD89521 243 WTPNGrgpaaTVGTGETVRVYFVDGGPNLSSSFHPIGSVWETLYPEGSLTTEPQTHIQTRQVPPGSTTIATMSSPVPGDF 322 Haloferax denitrifi...
CAB93142 249 ITPDRhg-spSMQVGETARVYFVTGGPNLDSSFHPIGSVWDEVWQQGSIAGPPNRYVQTTPVKPGSCAIATLHAEVPGPI 327 Haloarcula marismortui
Q02219   250 IAGDNa---lKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN--VQSTIVPAGGSAIVEFKVDIPGSY 324 Neisseria gonorrhoeae
Q60214   264 LTGEN-----ALTAAVGERVLIVHSQANRDTRPHLIGGHGEYVWRTGKFVNVPDRDQETWFIPGPTRGAAYYTFEQPGIY 338 Rhizobium sullae
2DWT_A   216 LTGEG-----ALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVY 290 Rhodobacter sphaero...
1KBW_A   210 LTGDNa---lKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN--VQSTIVPAGGSAIVEFKVDIPGNY 284 Neisseria gonorrhoeae
1NDR_A   217 LTGAN-----ALTAAVGESVLIIHSQANRDSRPHLIGGHGDWVWTTGKFANPPQLNMETWFIPGGSAAAALYTFKQPGTY 291 Achromobacter xylos...
1NIB_A   302 AYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPA 338 Achromobacter cycloclastes
P25006   340 AYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPA 376 Achromobacter cycloclastes
Q06006   320 VYLSHNLIEAMELGALAQIKVEGQWDDDLMTQVKAPG 356 Pseudomonas chlororaphis subsp. chlororaphis
Q53239   334 AYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPV 370 Rhodobacter sphaeroides ATCC 17025
CAD89521 323 KLVDHSLSRVVRKGCMAVVRAEGPEDPEIFDPDPDPQ 359 Haloferax denitrificans
CAB93142 328 KLVDHALSRVARKATMAIINREGAANPDVFEPEA--- 361 Haloarcula marismortui
Q02219   325 TLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSDT 361 Neisseria gonorrhoeae
Q60214   339 AYVNHNLIEAFELGAAAHFKVTGDWNDDLMTTVRSPS 375 Rhizobium sullae
2DWT_A   291 AYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPV 327 Rhodobacter sphaeroides
1KBW_A   285 TLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSDT 321 Neisseria gonorrhoeae
1NDR_A   292 AYLSHNLIEAMELGAAAQASVEGQWDDDLMTSVAAPG 328 Achromobacter xylosoxidans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap