1BQK,1ADW,1PAZ,1PMY,3TU6


Conserved Protein Domain Family
pseudoazurin

?
TIGR02375: pseudoazurin 
Click on image for an interactive view with Cn3D
pseudoazurin
Pseudoazurin, also called cupredoxin, is a small, blue periplasmic protein with a single bound copper atom. Pseudoazurin is related plastocyanins. Several examples of pseudoazurin are encoded by a neighboring gene for, or have been shown to transfer electrons to, copper-containing nitrite reductases (TIGR02376) of the same species. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131428
View PSSM: TIGR02375
Aligned: 13 rows
Threshold Bit Score: 163.792
Threshold Setting Gi: 39576198
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BQK_A                     7 MLNKGKDG---AMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYG 83  Ach...
CAC47409                  28 MLNKAADGr--VMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVG 105 Sin...
AAK08124                  32 MVHNGSTG---AKAFEPAFIQASVGDTVTFVPVDKGFNAEIIPGMLPLGARGFRGGMNEPVTITLTQEGVWGVKSMPYYG 108 Rho...
P04171                    32 MLNSGPGG---MMVFDPALVRLKPGDSIKFLPTDKGHNVETIKGMAPDGADYVKTTVGQEAVVKFDKEGVYGFKCAPHYM 108 Met...
CAE80363                   1 MLNNGKEG---IMVFEPAYLKAAKGDTIKFVPTDPAHDVSSV--VIPKSAKAFSAPSNKPLTIKVSEEGVYVYECKAHLP 75  Bde...
P80401                    29 MLNKGESG---AMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFG 105 Par...
P19567                    35 MLNKGKDG---AMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYG 111 Ach...
P04377                    30 MLNKGAEG---AMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYA 106 Alc...
tigr:EBAC080-L028H02.137  36 MLNKSAADpkiKMVFEPSYIAIAPGDCVKFLPTSKGHNAETIKKMYPKAAKKFKSKVNKEFVVRLEVEGLYGIKCTPHYQ 115 unc...
1ADW_A                     7 MLNKGESG---AMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFG 83  Par...
1PAZ_A                     7 MLNKGAEG---AMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYA 83  Alc...
1PMY_A                     7 MLNSGPGG---MMVFDPALVRLKPGDSIKFLPTDKGHNVETIKGMAPDGADYVKTTVGQEAVVKFDKEGVYGFKCAPHYM 83  Met...
3TU6_A                     8 MLNKAADGr--VMAFEPAVIRAQPGDTVTFVAKDKGHNSALMKGGAPEGAETWKGKINEEITVTLSKPGVYMYQCAPHVG 85  Sin...
1BQK_A                    84 MGMVGVVQVGDAp----ANLEAVKGAKNPKKAQERLDAALAAL 122 Achromobacter cycloclastes
CAC47409                 106 MGMIGAIVVGEP-----ANLEAVKGIKYPGKSKAAAEKIFAEI 143 Sinorhizobium meliloti 1021
AAK08124                 109 MGMVAVIQVGSP-----VNLDEAMSIPQPARAQARMEPIFAQV 146 Rhodobacter sphaeroides
P04171                   109 MGMVALVVVGDKr----DNLEAAKSVQHNKLTQKRLDPLFAQI 147 Methylobacterium extorquens AM1
CAE80363                  76 MAMVGVIQVGNPtnlkeAQDKAKELAKTFAMNKDRLDKYLTQV 118 Bdellovibrio bacteriovorus HD100
P80401                   106 MGMVGLVQVGDAp----ENLDAAKTAKMPKKARERMDAELAQV 144 Paracoccus pantotrophus
P19567                   112 MGMVGVVQVGDAp----ANLEAVKGAKNPKKAQERLDAALAAL 150 Achromobacter cycloclastes
P04377                   107 MGMIALIAVGDSp----ANLDQIVSAKKPKIVQERLEKVIASA 145 Alcaligenes faecalis
tigr:EBAC080-L028H02.137 116 MGMVALIQVGEVs---eESLSKSAKVKHRGKAKDRFKMLFSAL 155 uncultured marine bacterium 582
1ADW_A                    84 MGMVGLVQVGDAp----ENLDAAKTAKMPKKARERMDAELAQV 122 Paracoccus pantotrophus
1PAZ_A                    84 MGMIALIAVGDSp----ANLDQIVSAKKPKIVQERLEKVIASA 122 Alcaligenes faecalis
1PMY_A                    84 MGMVALVVVGDKr----DNLEAAKSVQHNKLTQKRLDPLFAQI 122 Methylobacterium extorquens
3TU6_A                    86 MGMIGAIVVGEP-----ANLEAVKGIKYPGKSKAAAEKIFAEI 123 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap