Conserved Protein Domain Family
nitri_red_nirB

?
TIGR02374: nitri_red_nirB 
nitrite reductase [NAD(P)H], large subunit
[Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 162827
View PSSM: TIGR02374
Aligned: 4 rows
Threshold Bit Score: 1208.12
Threshold Setting Gi: 490012371
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08201         6 LAIIGNGMVGHRFIEDLLDKSdAANFDITVFCEEPRIAYDRVHLSSYFS-HHTAEELSLVREGFYEKHGIKVLVGERAIT 84  Escherichia col...
P42435         6 LVLVGNGMAGVRAIEEILSVA-KDEFQITIFGAEPHPNYNRILLSKVLQgDTDIKDITLNDWDWYEENNIQLYTNETVIK 84  Bacillus subtil...
BAA06352       6 LVLAGNGMAGIRCIEEVLKLN-RHMFEIVIFGSEPHPNYNRILLSSVLQgEASLDDITLNSKDWYDKHGITLYTGETVIQ 84  Bacillus subtilis
WP_003915048  34 IVVVGHGMVGHRLVEAVRARDaDGSLRITVLAEEGDAAYDRVGLTSYTE-SWDRALLALPGNDYAGDQRVRLLLNTRVTQ 112 Mycobacterium t...
P08201        85 INRQEKVIHSSAGRTVFYDKLIMATGSYPWIPPIKGSDTQDCFVYRTIEDLNAIESCARRSKRG------AVVGGGLLGL 158 Escherichia col...
P42435        85 VDTENKTVITDADRIQPYDELILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKA------AVIGGGLLGL 158 Bacillus subtil...
BAA06352      85 IDTDQQQVITDRKRTLSYDKLIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKA------AVIGAGLLGL 158 Bacillus subtilis
WP_003915048 113 IDRATKSVVTAAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGghtdggVVIGGGLLGL 192 Mycobacterium t...
P08201       159 EAAGALKNLGIETHVIEFAPMLMAEQLDQMGGEQLRRKIESMGVRVHTSK--NTLEIVQEGv-eARKTMRFADGSELEVD 235 Escherichia col...
P42435       159 EAARGLLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEK--QTEEIVGDD---RVEGLRFKDGTSIEAD 233 Bacillus subtil...
BAA06352     159 EAAVGLQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEK--DTVSISGAT---KADRIHFKDGSSLKAD 233 Bacillus subtilis
WP_003915048 193 EAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHVGTgtESIESVKHSdgsVWARVRLSDGEVIDAG 272 Mycobacterium t...
P08201       236 FIVFSTGIRPRDKLATQCGLDVAprGGIVINDSCQTSDPDIYAIGECASWNNRVFGLVAPGYKMAQVAVDHILGSE-NAF 314 Escherichia col...
P42435       234 LVVMAVGIRPNTTLGAESGIPVN--RGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLAKHMCGIEtKPY 311 Bacillus subtil...
BAA06352     234 LIVMAAGVKPNIELAVSAGIKVN--RGIIVNDFMQTSEPNIYAVGECAEHNGTVYGLVAPLYEQGKALASHICGVPcEEY 311 Bacillus subtilis
WP_003915048 273 VVIFAAGIRPRDELARAAGLAIGdrGGVLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGS-AEF 351 Mycobacterium t...
P08201       315 EGADLSAKLKLLGVDVGGIGDAHgRTPGARSYVYLDESKEIYKRLIVSEDNktLLGAVLVGDTSDYGNLLQLVLNAIELP 394 Escherichia col...
P42435       312 EGSVLSTQLKVSGVEVFSAGDFN-ESEEKKAIKVFDEQDGIYKKIVLRGNQ--IVGAVLFGDSSEGNRLFSMIQKEADIS 388 Bacillus subtil...
BAA06352     312 QGSAPSAALKIAGIDVWSAGKIQ-EDERTTSIKIYDEQAGVYKKALFVDDK--LR-VILFGDTRDKQRLLDSLLKQRDIS 387 Bacillus subtilis
WP_003915048 352 PEADLSTKLKLLGVDVASFGDAMgATENCLEVVINDAVKRTYAKLVLSDDAttLLGGVLVGDASSYGVLRPMVG--AELP 429 Mycobacterium t...
P08201       395 ENPdSLILPAHSGSGKPSIGVDKLPDSAQICSCFDVTKGDLIAAINKG-CHTVAALKAETKAGTGCGGCIPLVTQVLNAE 473 Escherichia col...
P42435       389 ETS-KISILQPLSQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKgCSSTDEIKACTGASRSCGGCKPLVEEILQHT 467 Bacillus subtil...
BAA06352     388 -----IAKKQIIEPETSGPLFESMPSSETICQCNTVTKGAIEDAVHTNsLTTVEEVKHCTKATGSCGGCKPLVEDLLRYM 462 Bacillus subtilis
WP_003915048 430 GDPlALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIADG-CGDVPALKSCTAAGTSCGSCVPLLKQLLEAE 508 Mycobacterium t...
P08201       474 LAKQGI--E--VNNNLCEHFAYSRQELFHLIRVEGIKTFEELLAKHGKGY--GCEVCKPTVGSLLASCWNEYILKPEHTP 547 Escherichia col...
P42435       468 LGSDFD--AsaQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTpeGCSKCRPALNYYLGMINPTKYEDDRTSR 545 Bacillus subtil...
BAA06352     463 TNSEYTkpA--STPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTknGCSTCVPAIQYYLEMLYPGFVQPEPAT- 539 Bacillus subtilis
WP_003915048 509 GVEQ--------SKALCEHFSQSRAELFEIITATEVRTFSGLLDRFGRGK--GCDICKPVVASILASTGSDHILDGEQAS 578 Mycobacterium t...
P08201       548 LqdSNDNFLANIQKDGTYSVIPRSPGGEITPEGLMAVGRIAREFNL-YTKITGSQRLAMFGAQKDDLPEIWRQLIEAGFe 626 Escherichia col...
P42435       546 F--VNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIpLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSG- 622 Bacillus subtil...
BAA06352     540 --------------EETCILIPQMYGGRTNAEQLRTIANIIEAYSIpDVSITHGQRLKLSGIKPADLPNMKKDLKMPVYt 605 Bacillus subtilis
WP_003915048 579 LqdSNDHFLANIQKNGSYSVVPRVPGGDIKPEHLILIGQIAQDFGL-YTKITGGQRIDLFGARVDQLPLIWQRLVDGGMe 657 Mycobacterium t...
P08201       627 tgHAYAKALRMAKTCVGSTWCRYGVGDSVGLGVELENRYKGIRTPHKMKFGVSGCTRECSEAQGKDVGIIATEKGWNLYV 706 Escherichia col...
P42435       623 --YAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYV 700 Bacillus subtil...
BAA06352     606 --NEHRHALQSIKACTCGQ-----NRSIQQLAAQIERQLEMLPLPAPISISLS-CETDCTEAALQDVGAIRTQAGWDIHI 677 Bacillus subtilis
WP_003915048 658 sgHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGCARECAEARGKDVGVIATEKGWNLYV 737 Mycobacterium t...
P08201       707 CGNGGMKPRHADLLAADIDRETLIKYLDRFMMFYIRTADKLTRTAPWLENLEggIDYLKAVIIDDK--LglNAHLEEEMA 784 Escherichia col...
P42435       701 GGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVG--LSHVQSVLNDPE--K--RQELNGRMN 774 Bacillus subtil...
BAA06352     678 GGVRGTHARSGALFCVTENEDSTAGMIKGLIQYYRETDHYLEGVHQWIDRLG--IVHIREVLFEED--L--RAQLLESLQ 751 Bacillus subtilis
WP_003915048 738 AGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYYIRTADRLQRTAPWVESLG--LDHVREVVCEDSlgL--AEEFEAAMQ 813 Mycobacterium t...
P08201       785 RLREAVLCEWTETVNTP 801 Escherichia coli K-12
P42435       775 ETLSVHKDPWKDFLEDK 791 Bacillus subtilis subsp. subtilis str. 168
BAA06352     752 TDLSLIQNPTVETGAYK 768 Bacillus subtilis
WP_003915048 814 RHVANYKCEWKGVLEDP 830 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap