1KOU,1MZU


Conserved Protein Domain Family
photo_yellow

?
TIGR02373: photo_yellow 
Click on image for an interactive view with Cn3D
photoactive yellow protein
Members of this family are photoactive yellow protein, a cytosolic, 14-kDa light-sensing protein which has a 4-hydroxycinnamyl (p-coumaric acid) chromophore covalently linked to a Cys residue. The enzyme 4-coumarate--CoA ligase as described by TIGR02372 is required for its biosynthesis. The modified Cys is in a PAS (pfam00989) domain, frequently found in signal transducing proteins. Members are known in alpha and gamma Proteobacteria that include Rhodobacter capsulatus, Halorhodospira halophila, Rhodospirillum centenum, etc.
Statistics
?
PSSM-Id: 131426
View PSSM: TIGR02373
Aligned: 6 rows
Threshold Bit Score: 216.224
Threshold Setting Gi: 28948684
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KOU_A     2 EHVAFG--SEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKF 79  Halorhodospira halo...
P16113     2 EHVAFG--SEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKF 79  Halorhodospira halo...
Q53120     2 EMIKFG--QDDIENAMADMGDAQIDDLAFGAIQLDETGTILAYNAAEGELTGRSPQDVIGKNFFKDIAPCTDTEEFGGRF 79  Rhodothalassium sal...
O69138     2 EIIPFG--TNDIDNILAREP-ARAESLPFGAVLLDRMGRIAKYNKAEGLIAGRDPSTVIGRDFFNEIAPCAKGKRFHGEF 78  Rhodobacter capsula...
AAD22391   5 TTDDFGpfTEQIRGTIDGMGTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRF 84  Rhodospirillum cent...
1MZU_A     5 TTDDFGpfTEQIRGTIDGMGTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRF 84  Rhodospirillum cent...
1KOU_A    80 KEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 Halorhodospira halophila
P16113    80 KEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 Halorhodospira halophila
Q53120    80 REGVANGDLNAMFEYVFDYQMQPTKVKVHMKRAITGDSYWIFVKRV 125 Rhodothalassium salexigens
O69138    79 LKFNRTGQANVMLDYKFNYKGAEVAVKIHLKSQPDGQFCWLFVKRA 124 Rhodobacter capsulatus SB 1003
AAD22391  85 MDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRKL 130 Rhodospirillum centenum
1MZU_A    85 MDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRK- 129 Rhodospirillum centenum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap