Conserved Protein Domain Family
4_coum_CoA_lig

?
TIGR02372: 4_coum_CoA_lig 
4-coumarate--CoA ligase, photoactive yellow protein activation family
This model represents the 4-coumarate--CoA ligase associated with biosynthesis of the 4-hydroxy cinnamyl (also called 4-coumaroyl) chromophore covalently linked to a Cys residue in photoactive yellow protein of Rhodobacter spp. and
Statistics
?
PSSM-Id: 131425
View PSSM: TIGR02372
Aligned: 3 rows
Threshold Bit Score: 568.777
Threshold Setting Gi: 565826752
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O54075        12 RVLDREAIGRLCVSLIAAEQQdllrEGRVGHHQMIGARLLTAghpspdDLLIDEDTLGLDSLLMLSLVTRVAGFFHLSDS 91  Rhodobacter sph...
P42516         2 QGLNADEVLRLLRSLIPGELA----TGRGQRGDPPEAQDLCA------DSRLDAEPIRADSLDRLNLASALNRFFRLHET 71  Halorhodospira ...
WP_023911149  32 QAPDAAMVRRLLISLIRAEAR----RGRNQ--ILPEAA-FTG------DPRIDEEGLGFDSLARLDLIGAVRDFFDLSRT 98  Rhodobacter cap...
O54075        92 NTEDYLLVRR-------RLGEWVDLIDHHHTlmgPKARFTFATSGSTAGPKPVTHSAAALLSEGQAIAKILTerPPEVrr 164 Rhodobacter sph...
P42516        72 GVEDRLLAVR-------RIGDMAELIADASQ---HTSGLTFSTSGSTGTPQPHHHSWAALTQEAEALANALG--SHPR-- 137 Halorhodospira ...
WP_023911149  99 GIEDYVYVEPtlqgwidRIMQHFDLLAARS----ETAQAVFRTSGSTGTPKPIPHPWPKLMREAASMARDQGlvPAPGga 174 Rhodobacter cap...
O54075       165 VLSCVPAHHIYGFLWSCLFPSRRGLEAKQLANLSaSGIMRHARSGDLVVGTPFIWEQFADLDYRLPGdVVGVTSGAPSTA 244 Rhodobacter sph...
P42516       138 VIAWLPVHHLYGFVFGVALPRALGSTVIESHAAP-TALFREPAPDDLIATVPARWRYLFDSNHRFPG-GTGISSTAALET 215 Halorhodospira ...
WP_023911149 175 VIGLVPAHHLFGCLFTALLPELAGAALRDLTAAPpASALRTAQPGDLIIATPHLWAHLGAAGAFPPG-LRGVSSGAPMPD 253 Rhodobacter cap...
O54075       245 ETWRCASALGPARMLDIYGSTETGGIGWRERRDDPFRTLPDLACFHDTLSR------LGRRLDLQDEIAWDKDGGFTILG 318 Rhodobacter sph...
P42516       216 ACRNGLLQAGLDALLEVYGATEAGGIGLRWAPSEDYRLLPHWHGDATATSSalnpdgAAVTVAPLDRLQWRDERVFRPTG 295 Halorhodospira ...
WP_023911149 254 ALWHSLLAAGLEDLTEVYGASETGGIGLRRAPGAAFTLLPFLSRSADDGISd----gPAP-LPLQDRLRWTGPVRFVIEG 328 Rhodobacter cap...
O54075       319 RKDEILQVAGSNVSPAAVRDILLRNPRVRDAAVRLDGR----RLKAVISVA-EGADEAEIEIELRATAARHLPAPARPDR 393 Rhodobacter sph...
P42516       296 RIDDIIQIGGVNVSPGHVARRLESHEAVAACAVRSHGEgsrrRLKAFIVPArSDADPETLRQTLENWIWEHLPAVERPTD 375 Halorhodospira ...
WP_023911149 329 RLDQALQVGGVNVRLGHVKSVLEAEPGVEALALRLGGD----RLKAFVVCA-ADAEAG-LEARLRARAEAGLDAPARPQH 402 Rhodobacter cap...
O54075       394 FLFATELPRTGAGKLA 409 Rhodobacter sphaeroides 2.4.1
P42516       376 LRIGTELPRNAMGKLQ 391 Halorhodospira halophila
WP_023911149 403 YRFGRALPLTREGKAR 418 Rhodobacter capsulatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap