1OMO


Conserved Protein Domain Family
ala_DH_arch

?
TIGR02371: ala_DH_arch 
Click on image for an interactive view with Cn3D
alanine dehydrogenase, Archaeoglobus fulgidus type
This enzyme, a homolog of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric, NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other Archaea. For a number of close homologs, scoring between trusted and noise cutoffs, it is not clear at present what is the enzymatic activity.
Statistics
?
PSSM-Id: 131424
View PSSM: TIGR02371
Aligned: 3 rows
Threshold Bit Score: 577.638
Threshold Setting Gi: 50513267
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OMO_A     2 ETLILTQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVYLEFE--KGDLRAMPAHLMG--YAGLKWVNSHPGNPDKG 77  Archaeoglobus fulgidus
AAB85970  12 KTVVLTRSDVEGLLNMDDCLKAVEGAFVQEALGRVQMPPKMYLFFRryNGDLRVMPSYLEEleMAGVKCVNVHPSNPDRH 91  Methanothermobacter...
AAM06623   2 EVLWLAQEEVKSVVDMHSDMQVVESAFRQHGLGKVQMPPKSYLYYTvyNGDLRTMPAYLEEedITGVKIVNVHPGNPMRN 81  Methanosarcina acet...
1OMO_A    78 -LPTVMALMILNSPETGFPLAVMDATYTTSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAY 156 Archaeoglobus fulgidus
AAB85970  92 sLPTVMAVIELVDPETGFPIALMDGTHITDMRTGAAGGVSVKYLASRDASRLGIIGAGRQAWTQLMAISRVADLEEVSVY 171 Methanothermobacter...
AAM06623  82 -LPTVMALIILISPETGAPVAIMDGTYLTDIRTGAAGGVAAKYLARKDSKVIGLVGAGNQARTQLEALCEVFEPETVRIT 160 Methanosarcina acet...
1OMO_A   157 DVREKAAKKFVSYCE-DRG--ISASVQPAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKK 233 Archaeoglobus fulgidus
AAB85970 172 CRTPSTREKFALRASkEYEvpVRAATDPREAVEGMDIVVTVTPSRSPVVMADWVSPGTHICAMGADAPGKQELDPLILKN 251 Methanothermobacter...
AAM06623 161 SRTKESCDQFIKEMS-DFVpcEILYEESVEKVCDCDILVTTTPTRKPIVKASWVKEGTHINAIGADAVGKEELDPELLLR 239 Methanosarcina acet...
1OMO_A   234 AKIVVDDLEQAKHGGEINVAVSKGVIGVEDVHATIGEVIAGLKDGRESDEEITIFDSTGLAIQDVAVAKVVYENALSKNV 313 Archaeoglobus fulgidus
AAB85970 252 ARVFYDSLEQATHSGEINVPITEGILRVDDLQGSLGDVMTGKIEGRTSPADVTVFDSTGLSIQDITTAWMIYERAVAGEV 331 Methanothermobacter...
AAM06623 240 SKIIVDDMVQALHSGEVNVPLSKHYISENDIHAQLGEVIVGLKPGRTSEEEITIFDSTGLAIQDVATAHMVYERAVREGL 319 Methanosarcina acet...
1OMO_A   314 GSKIKFF 320 Archaeoglobus fulgidus
AAB85970 332 GLEVDLQ 338 Methanothermobacter thermautotrophicus str. Delta H
AAM06623 320 GRQVRMF 326 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap