Conserved Protein Domain Family
pyl_corrinoid

?
TIGR02370: pyl_corrinoid 
methyltransferase cognate corrinoid proteins, Methanosarcina family
This model describes a subfamily of the B12 binding domain (pfam02607, pfam02310) proteins. Members of the seed alignment include corrinoid proteins specific to four different, mutally non-homologous enzymes of the genus Methanosarcina. Three of the four cognate enzymes (trimethylamine, dimethylamine, and monomethylamine methyltransferases) all have the unusual, ribosomally incorporated amino acid pyrrolysine at the active site. All act in systems in which a methyl group is transferred to the corrinoid protein to create methylcobalamin, from which the methyl group is later transferred elsewhere.
Statistics
?
PSSM-Id: 131423
View PSSM: TIGR02370
Aligned: 4 rows
Threshold Bit Score: 276.681
Threshold Setting Gi: 21542130
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P58867     9 KLTNAIATQNVAGCAQLAQEALDAGISPLDIITKGLSPGMKIIGDKFEAAEVFLPQIMMSAKAMEAAMKVLTPELEKTkV 88  Methanosarcina acet...
O93659    10 KAKEAITDFDDELAEEVANEALAAGIDPVELIEKGFTAGMEEVGEKFGQGELFLPHVLAAAEAMNSGIKVITPEMEKRkS 89  Methanosarcina barkeri
Q8TS71    10 ELSDAIVSCKKDRVIAAVEKAKEV-MEPAEIIEKGLAAGMNQVGTLFERGKLFLPHVMMAADSMTAGVNILEAEMPAG-T 87  Methanosarcina acet...
AAK07607  44 PVAKAIFEGEEDDVVEGLQKAIDSGKDPIALINDSLMVGMGVVSKLYDDGVIFLPNVMMSADAMLEGIDFLKQKAGKA-- 121 Methanosarcina acet...
P58867    89 EgEEGTGLAITFVAEGDIHDIGHRLVTTMLGANGFDILDLGTDVLNETVVEEAAKHKGEkvLLVGSALMTTSMLGQKDLM 168 Methanosarcina acet...
O93659    90 Q-TKSLGTVAIGTIEGDIHSIGKDIVASMLNIAGFKVVDLGRDVPINTFVEKVKELKPQ--VVASSALMTTTMVNQIQIE 166 Methanosarcina barkeri
Q8TS71    88 E-TKKLGVIVNGTVEGDVHDIGKSIVSTMLQSAGFEVHDIGRDVPIKNFVEKAKEVNAD--MIGLSALMTTTMQGQRDVI 164 Methanosarcina acet...
AAK07607 122 --PEVKGKVVCHVAEGDVHDIGKNIVVALLRANGYDVIDLGRDVPVDEVIETVEKESPL--MLTGTALMTTTMYAFKEIN 197 Methanosarcina acet...
P58867   169 DRLREENLRDSVKCMFGGAPVSSKWIDEIGADATAENAAEA 209 Methanosarcina acetivorans C2A
O93659   167 EQLKEAGVRDQVKTMVGGAPVTQDWADKIGADIYGESANDA 207 Methanosarcina barkeri
Q8TS71   165 ELLKEEGMRERVKVMVGGAPATQAWADKIGADCYAENASEA 205 Methanosarcina acetivorans C2A
AAK07607 198 DKLMEKGYR--IPFACGGGAVNQDFVSQYELGVYGEEASDA 236 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap