Conserved Protein Domain Family
trimeth_pyl

?
TIGR02369: trimeth_pyl 
trimethylamine:corrinoid methyltransferase
This model represents a distinct subfamily of pfam06253. All members here are trimethylamine:corrinoid methyltransferases that contain a critical pyrrolysine residue incorporated during translation via a special tRNA for a TAG (amber) codon. Known members so far are from the genus Methanosarcina. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with dimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates trimethylamine, leaving dimethylamine, and methylates the prosthetic group of its small cognate corrinoid protein, MttC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence.
Statistics
?
PSSM-Id: 131422
View PSSM: TIGR02369
Aligned: 2 rows
Threshold Bit Score: 978.791
Threshold Setting Gi: 190359345
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TTA9   3 KNNAVAGFNALNGVELNLFTTDELKAIHYATMDVLMNPGVQVSDPEARQIFKENGCEVDEKTNVVKIPEYLVRRALQLAP 82  Methanosarcina acetiv...
Q8TS73   3 QNNAVAGFSSLQGVELNLFTIDELKAIHYATMEVLMNPGVQVSDPEARQIFKENGCEVDEKTNVVKIPEYLVRRALQLAP 82  Methanosarcina acetiv...
Q8TTA9  83 SRFVLWGRDKKFNTVQECGGKVHWTCFGTGVKMCKYQDGKYVTVDSVEQDIADIAKLCDWAENIDYFSLPVSARDIAGQG 162 Methanosarcina acetiv...
Q8TS73  83 SRFVLWGRDKKYNTVQEAGGKVHWTCFGTGVKMCKYQSGKYVTVDSVEQDIADIAKLCDWTENIDYFSLPVSARDWAGKG 162 Methanosarcina acetiv...
Q8TTA9 163 AQDVHETLTPIANTAKHYHHIDPVGENVEYYRDIVTAYYGGDEEEARKKPIFSMLLCPTSPLELSVNACQVIIKGARFGM 242 Methanosarcina acetiv...
Q8TS73 163 AQDVHETLTPIANTAKHYHHIDPVGENVEYYRDIVKAYYGGDEEEARKKPIFSMLLCPTSPLELSVNACQVIIKGARFGM 242 Methanosarcina acetiv...
Q8TTA9 243 PVNVLSMAMSGGSSPVYLAGTLVTHNAEVLAGITLAQLTVPGTKVWYGSSTTTFDLKKGTAPVGSPELGLISASVAKLAQ 322 Methanosarcina acetiv...
Q8TS73 243 PVNVLSMAMSGGSSPVYLAGTLVTHNAEVLSGIVLAQLTVPGAKVWYGSSTTTFDLKKGTAPVGSPELGLISAAVAKLAQ 322 Methanosarcina acetiv...
Q8TTA9 323 FYGLPAFVAGTOSDAKIPDNQAGHEKTMTCLLPALAGANTLYGAGMLELGMTFSMEQLVIDNDIIKMTKKALQGVPVNEE 402 Methanosarcina acetiv...
Q8TS73 323 FYGLPSYVAGTOADAKIPDNQTGHEKTMTCFLPALAGANTIYGAGMLELGMTFSMEQLVIDNDIIKMVKKAMQGIEVSPE 402 Methanosarcina acetiv...
Q8TTA9 403 TLAVESIQKVGIGNNFLALKQTRQLVNYPSDPMLIDRRMFGDWAAAGSKDLASAAHDKVVDVLKNHVVKPIDADILKDMQ 482 Methanosarcina acetiv...
Q8TS73 403 TLAVDSIQKVGIGNNFLALKQTRLLVNYPSDPMLIDRRMYGDWAASGSKDLAAVANEKVTDVLKHHEVPPIDTDILKDMQ 482 Methanosarcina acetiv...
Q8TTA9 483 AVVDRADKA 491 Methanosarcina acetivorans C2A
Q8TS73 483 AIVDRADKA 491 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap