Conserved Protein Domain Family
dimeth_PyL

?
TIGR02368: dimeth_PyL 
dimethylamine:corrinoid methyltransferase
This family consists of dimethylamine methyltransferases from the genus Methanosarcina. It is found in three nearly identical copies in each of M. acetivorans, M. barkeri, and M. Mazei. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with trimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates dimethylamine, leaving monomethylamine, and methylates the prosthetic group of the small corrinoid protein MtbC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence.
Statistics
?
PSSM-Id: 131421
View PSSM: TIGR02368
Aligned: 3 rows
Threshold Bit Score: 944.834
Threshold Setting Gi: 190359065
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TTA5   1 MATEYALRMGDGKRVFLTKEKILEELEAGMANASDLGEIPDLSADEIDKLAEILMMPGKAVSVEQGMEVPVTHDIGTIRL 80  Methanosarcina acetiv...
P58970   1 MATEYALRMGDGKRVFLAREKIMEEIEAGTANAADLGEIPALSADEMNKLAEILMMPGKAVSVEHGMEIPVTHDIGTIRL 80  Methanosarcina mazei Go1
Q8TN68   1 MATEYALRMGDGKRIYLTKEKILSEIEAGSSNAADLGDIPDLSTDEMKKLAEILMMPGKAVSVEQGMEVPVTHDIGTIRL 80  Methanosarcina acetiv...
Q8TTA5  81 DGDQGNSGVGIPSSRLVGCMTHERAFGADTMELGHIDYSFKPVKPVVSNECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160 Methanosarcina acetiv...
P58970  81 DGDQGNSGVGIPSSRLVGCMMHERAFGADTMELGHIDYSFKPVKPVVANECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160 Methanosarcina mazei Go1
Q8TN68  81 DGDQGNSGVGIPSSRLVGCMTHERAFGADTMELGHIDYSFKPVKPVVSNECQAMEVCQQNMIIPLFYGAMPNMGLYYTPD 160 Methanosarcina acetiv...
Q8TTA5 161 GPFENPGDLMKAFKIQEAWESMEHAAEHLTRDTVWVMQKLFASGTDGVNFDTTAAAGDADMYGTLHAIEALRKEFPDMYI 240 Methanosarcina acetiv...
P58970 161 GPFENPGDLMKAFKIQEAWDSMEHAAEHLTRDTIWIMQKLFASGADGVNFDTTAAAGDGDFYGTLHAIEALRKEFPEMYI 240 Methanosarcina mazei Go1
Q8TN68 161 GPFENPGDLMKMFKIDKARESMEHAADHLTRDTVWVMQKLFASGADGVNFDTTAAAGDADMYGTLRAVEVLRAQFPEMYI 240 Methanosarcina acetiv...
Q8TTA5 241 EAGMAGECVLGMHGNLQYDGVTLAGLWPHQQAPLVAKAGANVFGPVCNTNTSKTSAWNLARAVNFMKAAVQASPIPCHVD 320 Methanosarcina acetiv...
P58970 241 EAGMAGEMVLGMHGNLQYDGVTLAGLWPHQQAPLVAKAGANVFGPVVNTNTSKTSPWNLARAVTFIKEAVKVSSLPCHVD 320 Methanosarcina mazei Go1
Q8TN68 241 EVGMAGEMVLGMHGELEYDEVRLAGLWPHEQAPLIAKAGANVFGPVVNTNTSKTSAWNLARAVTFIKEAVKASPIPCHVN 320 Methanosarcina acetiv...
Q8TTA5 321 MGMGVGGIPMLETPPVDAVTRASKAMVEVAGVDGIOIGVGDPLGMPISHIMASGMTGIRAAGDLVARMQFSKNMRIGEAK 400 Methanosarcina acetiv...
P58970 321 MGMGVGGIPMLETPPIDAVTRASKAMVEIAGVDGIOIGVGDPLGMPISHIMASGMTGMRAAGDLVARMQFSKNMKIKEAK 400 Methanosarcina mazei Go1
Q8TN68 321 MGMGVGGIPMLETPPVDAVTRASKAMVEVAGVDGIOIGVGDPLGMPISHIMASGMTGIRAAGDLVARMEFSKNMRIGEAK 400 Methanosarcina acetiv...
Q8TTA5 401 EYVAKKLNVDVMDLADEHVMRELREELDIGVITSVPGAAKGIAAKMNIEKLLDIKINSCNLFRKQI 466 Methanosarcina acetivorans C2A
P58970 401 EYVAKKLNVEIRDLADEYIMRELREELNIGVITSVPGSAKGIAAKMNIEKLLGIKINSCELFRKQT 466 Methanosarcina mazei Go1
Q8TN68 401 EYVAKKLNVDTMDLADEHVMRELREELDIGVITSVPGAAKGIAAKMNIEKLLGIKINSCETFRAQL 466 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap