3B48


Conserved Protein Domain Family
dha_pts

?
TIGR02364: dha_pts 
Click on image for an interactive view with Cn3D
dihydroxyacetone kinase, phosphotransfer subunit
In E. coli and many other bacteria, unlike the yeasts and a few bacteria such as Citrobacter freundii, the dihydroxyacetone kinase (also called glycerone kinase) transfers a phosphate from a phosphoprotein rather than from ATP and contains multiple subunits. This protein, which resembles proteins of PTS transport systems, is found with its gene adjacent to
Statistics
?
PSSM-Id: 131417
View PSSM: TIGR02364
Aligned: 13 rows
Threshold Bit Score: 122.436
Threshold Setting Gi: 38201135
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3B48_A         6 ADILLVSHSKXITDGIKEXIEQXNAsEEITIHSLGGT--SDGSLGSDPXKIIDTINEaDS-DREFLIFADLGSAVLSSEL 82  Enterococcus fa...
AAM25173       7 VGIVLVSHSRKIVEGVFELVNQMTR-GKVPIGIAGGT--PDGRLGTDAAEIVEQVKKvDR-GEGVVVLVDIGSAVMSAQT 82  Caldanaerobacte...
P37349         2 VNLVIVSHSSRLGEGVGELARQMLMsDSCKIAIAAGIddPQNPIGTDAVKVMEAIESvAD-ADHVLVMMDMGSALLSAET 80  Escherichia col...
CAE50858       4 VGLVLVSHSQKLAEGLADLAAQMAG--DVHIVSAGGL--DDGGIGTSYDRIEAAVTEvRNgGEGVVILTDLGSATMTVEM 79  Corynebacterium...
BAC48838       5 VGIVIVSHSKDIAKGTADMVRQMVG-SEVKVAFCGGN--PDGGLGTSVSLIIDAINDaWS-AKGVAILVDLGGAETNSEM 80  Bradyrhizobium ...
BAC14428       4 VGIVLISHSVKIAEGTKELVQQVMK--DVTVEVAGGT--DEGEIGTSIDKILNAITKa-NkDDGVLLLYDIGSAKMNAEM 78  Oceanobacillus ...
AAO81150       3 ADILLVSHSKMITDGIKEMIEQMNAsEEITIHSLGGT--SDGSLGSDPMKIIDTINEaDS-DREFLIFADLGSAVLSSEL 79  Enterococcus fa...
BAC44127       2 VGIIVVSHSFLLGQEIIKLCNEMKK-NNFEIINCSGL--DKNTFGSDPIKIKEAIENnIKgNEGVFVFCDLGSSILNSQL 78  Mycoplasma pene...
WP_001124168   2 PKIILVSHSKEIASGTKSLLKQMAG--DVDIIPIGGL--PDGSIGTSFDIIQEVLT---KlEDDALCFYDIGSSEMNVDM 74  Staphylococcus ...
WP_003723202   2 ISIVLVSHSQKITEGLQEMIVEMVG-DTVHIISSGGT--GDGRLGTNAIMIADNIATcTN-SEHIYIFCDIGSAILSAET 77  Listeria monocy...
AAL93941       4 VGFVVVSHSKELAEAAIHLANEMKR-YDFPLINGSGT--DGNFLGSNPLIIKEAILK-AKtDKGALIFVDIGSSVLNTQV 79  Fusobacterium n...
WP_010899536   6 FGIVISSHVPALAEGIVTLLKEAAK--DVSITYAGGT--DDDQVGASFEKIQQAVMD--NeADELFVFYDLGSAKMNVEM 79  Bacillus halodu...
WP_009930438   5 YGVVIISHSKDVAKGVHDIIKEIAP--DVSITHAGGT--EDGRIGTSFDAVNEAIEN--NeANKVYTFYDLGSAKMNIET 78  Listeria monocy...
3B48_A        83 AFDXLEEDQQK--HYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQNAG 130 Enterococcus faecalis V583
AAM25173      83 AVELLGEEYEG--KVKIADAPLVEGAVAAAVEASIGSDFEKVLTVAEEAK 130 Caldanaerobacter subterraneus subsp. tengcong...
P37349        81 ALELLAPEIAA--KVRLCAAPLVEGTLAATVSAASGADIDKVIFDAMHAL 128 Escherichia coli K-12
CAE50858      80 VVDMADDPD-----VVFVDAPFVEAAIAAAVAAQQGGSTADVAAAARGAI 124 Corynebacterium diphtheriae
BAC48838      81 AVEMLEPARRD--LVVVCNAPIVEGAVMAATEAAGGSSLAQVKAVAEELS 128 Bradyrhizobium diazoefficiens USDA 110
BAC14428      79 AVEMTEVDD-----VELIEAPLVEGAYVAAVESGMGKEKHEIIEAVTQSF 123 Oceanobacillus iheyensis HTE831
AAO81150      80 AFDMLEEDQQK--HYHLVDAPLVEGAFASAITAGVSDDLTQILAEAQNAG 127 Enterococcus faecalis V583
BAC44127      79 AIDLIEDESIDksKIIIADAPIVEGTLVASTLN-FDGNFNQIIDELKQLK 127 Mycoplasma penetrans HF-2
WP_001124168  75 AIEMYDGNHR----VLKVDAPIVEGSFIAAVKLSIGGSIDDALAEIKQSF 120 Staphylococcus aureus
WP_003723202  78 ALELLDTDLLE--KTTIIDAPLVEGAFTAAVQSLVNPSKEAILQELTNVH 125 Listeria monocytogenes
AAL93941      80 AIDFLADEDVDieNIKIADVPLVEGLIAGVAVNDEKADIESVLEELNELK 129 Fusobacterium nucleatum subsp. nucleatum ATCC...
WP_010899536  80 VMELSEKT------IHLMDVALVEGAYTAAALTQGGASF-ETIMEQLQPL 122 Bacillus halodurans
WP_009930438  79 VEEISEKE------IILFNAPILEGAYATAAQVQMD-EKPEVIAANLKTI 121 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap