1D7L


Conserved Protein Domain Family
pbenz_hydroxyl

?
TIGR02360: pbenz_hydroxyl 
Click on image for an interactive view with Cn3D
4-hydroxybenzoate 3-monooxygenase
Members of this family are the enzyme 4-hydroxybenzoate 3-monooxygenase, also called p-hydroxybenzoate hydroxylase. It converts 4-hydroxybenzoate + NADPH + molecular oxygen to protocatechuate + NADPH + water. It contains monooxygenase (pfam01360) and FAD binding (pfam01494) domains. Pathways that contain this enzyme include the protocatechuate 4,5-degradation pathway. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131413
View PSSM: TIGR02360
Aligned: 8 rows
Threshold Bit Score: 725.783
Threshold Setting Gi: 38490075
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1D7L_A     1 MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFA 80  Pseudomonas aerugin...
BAC53103   1 MRTKVAIIGAGPAGLLLGQLLHNYGIDNFILERQSPDYVLGRIRAGLLEEGTVALLDQVGAGVRAHAEGLVHEGIELAFS 80  Bradyrhizobium diaz...
Q03298     4 MKTKVAIIGSGPAGLLLGQLLYKAGIEHVIVEQRSADYVASRIRAGILEQVSVDLLEQAGVDQNLKEKGLPHSGIEILTN 83  Acinetobacter sp. ADP1
P20586     1 MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFA 80  Pseudomonas aerugin...
BAC47602   1 MKVQVCIIGGGPSGLLLSQLLHLKGIDTVVLEKYSRDHVLARIRAGVLEHGFAKLMREAQCGERMDREGEIHRGFEIAHD 80  Bradyrhizobium diaz...
AAF65831   1 MKTQICIVAGGPSGLLLGQLCHQAGIDAIVLERRSRKHVLSRIRAGVLEQGFVDLLQEAKVATRMDTEGYPHDGTVISFE 80  Sagittula stellata ...
AAR21635   1 MRTQVCIIGGGPSGLLLGQLLHRQGIATVILERKTRDYVLGRIRAGILETGTADLLRQAGAGDRMDRESFAHEGTVIAYG 80  Roseovarius nubinhi...
AAK24375   1 MRTQVAIVGAGPAGLFLGHLLRQAGVDVVILERKDRAYVEGRVRAGVLERITVELMERLGVDERMRREGLVHAGANLASD 80  Caulobacter crescen...
1D7L_A    81 GQRRRIDLKRLSGgKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERP---YVTFERDGERLRLDCDYIAG 157 Pseudomonas aerugin...
BAC53103  81 GRRHRIDMKAATG-KTVMIYGQTEVTLDLMNARKAAGLDTVYEAKDVRPHDFDGSHP---RVTWVRDGVTHTLDCDFIAG 156 Bradyrhizobium diaz...
Q03298    84 GQKFRVDLSALTQgKQVTVYGQTEVTKDLMQAREQAGLCSFYESNDVQIHDFYN-AP---KVTFESNGTHYQIECDFIAG 159 Acinetobacter sp. ADP1
P20586    81 GQRRRIDLKRLSGgKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERP---YVTFERDGERLRLDCDYIAG 157 Pseudomonas aerugin...
BAC47602  81 GVLSHIDLHKHSGgNSVLVYGQTELTRDLYEARDRLGGKVVHNAEDVTPHDLASDRP---YVTYRSNDEIVRVDCDYIVG 157 Bradyrhizobium diaz...
AAF65831  81 DMEVRVDFRKHTG-TSVMVYGQTEVTRDLYEARDQTGGLTLHDVDEVELGNAALDGDegcTVSFTHDGQRKTIECDYIAG 159 Sagittula stellata ...
AAR21635  81 DTQFGVNFHAHTG-RDVIVYGQTELTRDLYDAREAAGAPTLFNVDHVTIHDAKSDAP---HVTYHVAGTEHRIDCDFIAG 156 Roseovarius nubinhi...
AAK24375  81 GEMFRIDMAELTGgSTVMVYGQQEVMKDLFDAAEQRDLRIVFDADAVRLHDVEGERP---HITWRKDGAEHRLDCDFIAG 157 Caulobacter crescen...
1D7L_A   158 CDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDE 237 Pseudomonas aerugin...
BAC53103 157 CDGFHGVSRASVPASAIEEFERVYPFGWLGILSETPPVSHELIYSNHALGFALCTMRSMKRSRYYVQCSLDDHVDQWPDD 236 Bradyrhizobium diaz...
Q03298   160 CDGYHGVCRASVPQDKIKTFEKVYPFGWLGVLADVPPVADELIYVQSERGFALCSMRSETRSRYYIQVPLTDHVENWSDD 239 Acinetobacter sp. ADP1
P20586   158 CDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDE 237 Pseudomonas aerugin...
BAC47602 158 ADGFHGVSRKSIPKDVLREYEKVYPFGWLGVLSRTKPVSSELIYVKHERGFALCSLRSQVLSRYYIQVPLTDKVKDWSDD 237 Bradyrhizobium diaz...
AAF65831 160 CDGFHGPSRRAIPAEKRKEFERVYPFGWLGILSETPPAHHELIYANSERGFALCSMRNERLSRYYLQAPLTDRVEDWSDD 239 Sagittula stellata ...
AAR21635 157 CDGFHGVSRQTIPLSVRREYEKIYPFGWLGILSETPPVHDELIYSGSERGFALCSMRSATLSRYYIQCALSDSPEDWSDA 236 Roseovarius nubinhi...
AAK24375 158 CDGYHGVSRATIPDKVLKTFERVYPFGWLGILAEAPPCDHELIYSNHDRGFALASMRSPTRSRYYVQCSLDDRLEDWSDE 237 Caulobacter crescen...
1D7L_A   238 RFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAY 317 Pseudomonas aerugin...
BAC53103 237 RFWDELKRRLDQEAADSLVTGPSIEKSIAPLRSFVAEPMRFGKMFLCGDAAHIVPPTGAKGLNLAASDAHYLSSALREFY 316 Bradyrhizobium diaz...
Q03298   240 QFWEELKNRLDPESCEKLVTGPSIEKSIAPLRSFVTEPMRFGKLFLAGDAAHIVPPTGAKGLNLAASDIAYLSSALIEFY 319 Acinetobacter sp. ADP1
P20586   238 RFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAY 317 Pseudomonas aerugin...
BAC47602 238 AFWAELKRRLPEEVAGRLITGPAIEKSIAPLRSFVAEPMSYGRLFLAGDAAHIVPPTGARGLNSAASDIYYLYHAMLAHY 317 Bradyrhizobium diaz...
AAF65831 240 AFWAELKRRIPSRIAETLVTGPSIEKSIAPLRGFVCEPMQYGRLFLAGDAAHIVPPTGAKGLNTAASDIHYLFEALKARY 319 Sagittula stellata ...
AAR21635 237 NFWEELKRRIPEDAADRLITGPSIEKSIAPLPSFVCEPMQWGRLFLCGDAAHIVPPTGAKGLNTAASDVHYLYTGLRQHY 316 Roseovarius nubinhi...
AAK24375 238 RFWDEVSVRLGPEAAARIVRAPSFEKSIAPLRSFVSEPMRYGRLFLAGDAAHIVPPTGAKGMNLAVSDVIMLSEALVEHY 317 Caulobacter crescen...
1D7L_A   318 REGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPY 390 Pseudomonas aeruginosa PAO1
BAC53103 317 DEKSSAGIDAYSAKALARVWKAVRFSWWMTSMLHKFPDTGAIGARIQLAELDYVTQSQAAMSSLSENYVGLPF 389 Bradyrhizobium diazoeffici...
Q03298   320 TQGSEQGIDQYSEKCLQRVWKAERFSWWMTHLLHRFETESEFDHKIKQAELSYILGSTAGQTTLAENYVGLPY 392 Acinetobacter sp. ADP1
P20586   318 REGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPY 390 Pseudomonas aeruginosa PAO1
BAC47602 318 QSGDDSGLEGYSAKALARIWKAQRFSWWMTMLLHRFPDRLDYEDRLQQTELEYLFSSETAQRLLAENYVGLPF 390 Bradyrhizobium diazoeffici...
AAF65831 320 QERDAAAMGGYSERALARVWKTQRFSWWMTKLLHRFPDTDPYELRIQRAEIEHLATVESAQQTMAINYVGLPY 392 Sagittula stellata E-37
AAR21635 317 LDGDSDGIERYSERALARVWKAERFSWSTTNLLHRYPHQSEFDIKMQQAEVAFLRDNAAAQKVFAQNYVGLPY 389 Roseovarius nubinhibens
AAK24375 318 HERSSAGIDGYSARALARVWKAERFSWWFTSLTHRFPDQDGFDRKMQVAELAYIKGSRAAQVTLAENYVGLPL 390 Caulobacter crescentus CB15
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap