Conserved Protein Domain Family
thiW

?
TIGR02359: thiW 
energy coupling factor transporter S component ThiW
Levels of thiamine pyrophosphate (TPP) or thiamine regulate transcription or translation of a number of thiamine biosynthesis, salvage, or transport genes in a wide range of prokaryotes. The mechanism involves direct binding, with no protein involved,to a structural element called THI found in the untranslated upstream region of thiamine metabolism gene operons. This element is called a riboswitch and is seen also for other metabolites such as FMN and glycine. This protein family consists of proteins identified in operons controlled by the THI riboswitch and designated ThiW. The hydrophobic nature of this protein and reconstructed metabolic background suggests that this protein acts in transport of a thiazole precursor of thiamine. [Transport and binding proteins, Other, Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 131412
View PSSM: TIGR02359
Aligned: 6 rows
Threshold Bit Score: 148.702
Threshold Setting Gi: 18160942
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM24930       4 IHRMVFMALIIAIGTLTSqYVWFSVGVAKVTPVQHAINVISAVFLGPWGALEVAFIIGLLRNILGVGSLLAFPGGMVGAF 83  Caldanaerobacte...
BAC12432       4 TRVLTLMAVLVAIGTIGSqLLWFPAGVARAYPVQHAVNVMAAVLLGPGPAVGVALMIGLLRNLLGLGTLLAFPGGMIGAF 83  Oceanobacillus ...
AAO82475       6 IHRVTLLALMIAMDVVLSpLMRIEG----MAPMSSVMNIIAGVLLGPLYGTLMALVCGLIRMTFLGIPPLALTGAVFGAF 81  Enterococcus fa...
AAO04570       3 IRKLTITAFLIAINVVLSsLIVIPLGPIKAAPVQHFVNVLCAVFVGPWYGLAQAFISSVLRISFGTGSAFAFPGSMIGVL 82  Staphylococcus ...
AAL64258       3 YRVVAYLAVFTGLGLALA-PLSFPVGPTRAFPGQHFVNGVAGVVIGP-WALAVAFLISLIRNMLGLGTVFAFPGSIPGAL 80  Pyrobaculum aer...
WP_010866988   9 ERKLALAAILGGLAVALS-VIRIDVGPTKALPWQHMVNVVAGVTLGPWWASGLALAVGLVRMALGIGTVYSIPGGIPGAL 87  Aeropyrum pernix
AAM24930      84 IAGY----LYRFTRKFYFASIGEVIGTGIIGALLSYPIAKYILGSSG----AAFMFVIPFSLSSTIGSVIG-YVVVLVLA 154 Caldanaerobacte...
BAC12432      84 FAGI----LYRKWRRHRLAVTGEILGTGIVGSLLAVPFANFLMGSSV----GALAFLPAFIVSSVSGACIGwFILSRVHH 155 Oceanobacillus ...
AAO82475      82 FAGL----FYQWGQKLGWSMLGEIFGTGIIGSLLSYPVMVWFTGSKQn--fYWFIYTPRFIGATLIGSVIAwLVLVKLKE 155 Enterococcus fa...
AAO04570      83 LSSL----FYMYRKHIFMASVGEVLGTGVIGSLMCIPLA-WFLGLQDf---FIKPLMLMFIVSSFIGALISyILLIILKR 154 Staphylococcus ...
AAL64258      81 VVWLaataLRRFGKAHYAP-LFEPLGTLGLGFPAAAYVVAPLLGVGErfitGLIPIFIGWAASTITGSIAAfFVAVALRR 159 Pyrobaculum aer...
WP_010866988  88 LVGLgavaLLRLGRSPLPAGLLEPLGTAVIGFLLALYVFAPLMGDVEawrsALTVIWLGWLSSTLIGTTLGlAALVALER 167 Aeropyrum pernix
AAM24930     155 KYKKFI 160 Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAC12432     156 TELSHI 161 Oceanobacillus iheyensis HTE831
AAO82475     156 TRVFKQ 161 Enterococcus faecalis V583
AAO04570     155 RGLLDR 160 Staphylococcus epidermidis ATCC 12228
AAL64258     160 LG--RL 163 Pyrobaculum aerophilum str. IM2
WP_010866988 168 SGVVRL 173 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap