1JWB


Conserved Protein Domain Family
moeB

?
TIGR02355: moeB 
Click on image for an interactive view with Cn3D
molybdopterin synthase sulfurylase MoeB
This model describes the molybdopterin biosynthesis protein MoeB in E. coli and related species. The enzyme covalently modifies the molybdopterin synthase MoaD by sulfurylation. This enzyme is closely related to ThiF, a thiamine biosynthesis enzyme that modifies ThiS by an analogous adenylation. Both MoeB and ThiF belong to the HesA/MoeB/ThiF family (pfam00899). [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin]
Statistics
?
PSSM-Id: 131408
View PSSM: TIGR02355
Aligned: 6 rows
Threshold Bit Score: 426.533
Threshold Setting Gi: 24345520
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JWB_B     8 EMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKV 87  Escherichia coli K-12
AAP96520   7 EMLRYNRQIILQNVDFDGQEKLKASRVLIVGLGGLGCAAAQYLAAAGIGRLILVDFDEVSRSNLQRQILHSEANIGMPKV 86  Haemophilus ducreyi...
P45211     8 EELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCAASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDARLNMPKV 87  Haemophilus influen...
P12282     8 EMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKV 87  Escherichia coli K-12
AAN53224  12 ELTRYSRQISIKAMDIDGQERLKLAKVLMIGAGGLGCAAGQYLTVAGIGELTLVDFDTVELSNLQRQVLHQDANIGQPKV 91  Shewanella oneidens...
BAC62514   8 EMLRYNRQIILRQFDFEGQEALKQSSVLILGAGGLGCASSQYLATAGVGRITLIDDDIVELSNLQRQVLHHDTDIGRKKV 87  Vibrio parahaemolyt...
1JWB_B    88 ESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQ 167 Escherichia coli K-12
AAP96520  87 QSAKARLSEINPYIQIDAINQKCSSEQWASLIAKVDVVVDCTDNVEVRNQLNVQCFAQKRPLVSGSAIRFEGQISVFTYQ 166 Haemophilus ducreyi...
P45211    88 ESAKIALEQINPHINIETINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHMKVPLISGAAIRMEGQVSVFTYE 167 Haemophilus influen...
P12282    88 ESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQ 167 Escherichia coli K-12
AAN53224  92 ESAKQSLNQLNPHVKINPINAVLDDHEIDALVASHSIVVDCTDNVSVREQLNQSCFKHKVPLVSAAAIRMEGMVTVFDYQ 171 Shewanella oneidens...
BAC62514  88 DSAADALRELNPHVEVNTVAKRLDDAQLQALIEQHTVVVDASDNVDTRNQLNRLCFATKTPLISGAAIRMEGQVSVFTYD 167 Vibrio parahaemolyt...
1JWB_B   168 D-GEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEV 246 Escherichia coli K-12
AAP96520 167 A-DEPCYSCLSQLFGSGTLSCVEAGVIAPIVGVIGSLQALETIKLLLMIGTHLTGKLLIMDGLHFSIREMALPKLTTCPI 245 Haemophilus ducreyi...
P45211   168 P-NTPTYRDLSKLFRQNVLSCVEAGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGRLLMIDGFSMNIREIKLPTNME--- 243 Haemophilus influen...
P12282   168 D-GEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEV 246 Escherichia coli K-12
AAN53224 172 A-QTPCYHCFSSLFGEQQLSCVESGILAPVVGMVGCLQAVEAIKVITGIGKTLAGRILMIDAMTMEFREMKLPKQAHCKI 250 Shewanella oneidens...
BAC62514 168 DpTQPCYQCLSALFGSGALSCVEAGVMAPVVGIVGAVQAMETIKVIANYGQPKKGKILILDALSMSWREMNLIKMPTCPV 247 Vibrio parahaemolyt...
1JWB_B   247 C 247 Escherichia coli K-12
AAP96520 246 C 246 Haemophilus ducreyi 35000HP
P45211       -     Haemophilus influenzae Rd KW20
P12282   247 C 247 Escherichia coli K-12
AAN53224 251 C 251 Shewanella oneidensis MR-1
BAC62514 248 C 248 Vibrio parahaemolyticus RIMD 2210633
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap