Conserved Protein Domain Family
thiF_fam2

?
TIGR02354: thiF_fam2 
thiamine biosynthesis protein ThiF, family 2
Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with one the E. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the divergent clade of putative ThiF proteins such found in Campylobacter. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 162819
View PSSM: TIGR02354
Aligned: 3 rows
Threshold Bit Score: 344.16
Threshold Setting Gi: 28203841
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO36281      63 EEMEIQLVARHTPKVYEELRKASVAIAGLGGLGSTAALSLARIGIGKLILVDYDVVEPSNLNRQQYFIKHIGMKKTEAIK 142 Clostridium tet...
WP_002859169  64 DALDAMMRARHTPKLHDKLKNGRVAVCGLGGLGSHIAINLARSGVGYLKLIDFDVIEPSNLNRQAYRVSDLGKFKTEALK 143 Campylobacter j...
WP_014545016  10 EEFRRALVQKQGEEIVQKLEQATVAICGVGGLGSNVAINLARAGIKKLILVDFDRVDVTNLQRQQYKASQVGEPKAFALV 89  Fibrobacter suc...
AAO36281     143 DIISQCNPFVDIQTIDAYVDEKNMENIFKDADIIIEAFDNAETKALITNTVLTTMKDKKIITASGLAGYEDCNLIRSKKI 222 Clostridium tet...
WP_002859169 144 EQISEINPYISIEICTLKINEDNLKSLFKDIDIVCEAFDSAIAKAMMAQNFHRFYKDSILICASGLAGYGDSNSIQTRKI 223 Campylobacter j...
WP_014545016  90 ENLKEIAPYTEFEAYDEKITEENIDKFVANADVVCEAFDNPEAKSMLVNAVLEKYPQKYLVAASGMAGTDDANSIKTRKI 169 Fibrobacter suc...
AAO36281     223 NDRFYIVGDGQAEAKSGRGLMTPRVSVAANHQANLVLELI 262 Clostridium tetani E88
WP_002859169 224 AKNFYVCGDLVNGAKLGNGLMAPRVNICAGHQSNLVLELL 263 Campylobacter jejuni
WP_014545016 170 SKHFYLCGDGKSDVTQGLALLAPRVQICAAHEALTIIRII 209 Fibrobacter succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap