Conserved Protein Domain Family

TIGR02354: thiF_fam2 
thiamine biosynthesis protein ThiF, family 2
Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with one the E. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the divergent clade of putative ThiF proteins such found in Campylobacter. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
PSSM-Id: 162819
Aligned: 3 rows
Threshold Bit Score: 344.16
Threshold Setting Gi: 28203841
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_014545016 170 SKHFYLCGDGKSDVTQGLALLAPRVQICAAHEALTIIRII 209 Fibrobacter succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap