Conserved Protein Domain Family
thiH

?
TIGR02351: thiH 
thiazole biosynthesis protein ThiH
Members this protein family are the ThiH protein of thiamine biosynthesis, a homolog of the BioB protein of biotin biosynthesis. Genes for the this protein generally are found in operons with other thiamin biosynthesis genes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 131404
View PSSM: TIGR02351
Aligned: 8 rows
Threshold Bit Score: 592.411
Threshold Setting Gi: 19712994
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL93868       5 NINSNIMDk-VISEMNTYDYNSFSNEDVEEALNKD-YLSVKDFQALLSPKAINYLEEKAEKAKEFKERYFGNSVYIFTPL 82  Fusobacterium n...
BAC61285       2 SFYDRFQQ--LDWDDISMSIYAKTAQDVERALANP-KRDLEDFKALISPAAEPYLEQMAKLSYSLTRKRFGNTMSLYIPL 78  Vibrio parahaem...
AAN55474       2 SFVDHFAR--IERDKLLLALYSCTAADVERALVQP-EGNLQSLLALLSPAAEPYIEEMAQRSAALTRQRFGANIGLYLPL 78  Shewanella onei...
AAQ67066       2 TFYDHLHAspYTWERVGNLLADATAADVERSLAYR-RRTIQDFITLISPAAIPYLEQMARQAHALTVERFGHTMQLYIPL 80  Porphyromonas g...
BAC24650       3 TFKQYWEK--IKWNEVSKLISKCKFRDVENILNKN-FLLLNDAIPLLSKAASFYLESLAQKAKIITRTRFGNNINLFMPL 79  Wigglesworthia ...
AAO75756       1 MFSDELEK--ISWEETTKAIYSKTDADVRRALGKKeHLDVNDFMALISPAATPYLEVMARLSQKYTMERFGKTISMFVPL 78  Bacteroides the...
BAB81306       5 DVVEKYRD----FDFYGY-FDSVKKEDVLRSIYER-NKRPEDLLNLISPMGEELLEEMAQEARNLSLKYFGRTILLYTPM 78  Clostridium per...
WP_002864289   3 EIKSEILNk-VLTQVQSYDESQFSAKDVKNALNQT-HLSIEHLKALLSSAAEDFIEELAFKSAKVKQKYFGNSISLFTPL 80  Campylobacter j...
AAL93868      83 YISNYCDNYCVYCGFNSHNKIKRAKLDFEQIEQELKEIAKSG-LQEILILTGESERYSNIEYIGEACKLARKYFNNVGIE 161 Fusobacterium n...
BAC61285      79 YLSNLCANACTYCGFSMENRIKRRTLNRDEVEAEIDAIKRMK-FDSVLLVTGEHETKVGMKYFREMVPIIKQRFNYLAME 157 Vibrio parahaem...
AAN55474      79 YLSNLCANECDYCGFSMSNKLKRKVLNEQELAAEIAIIKSRG-FDSILLVSGEHETKVGMDYFQRVLPLVKQQFSYLAME 157 Shewanella onei...
AAQ67066      81 YLSNICSNACVYCGFSRSNKIHRRRLTAEEVDREAEAILRLG-YKHLLLVSGESEKATPASYYEKMTRRLRPLFSQLSLE 159 Porphyromonas g...
BAC24650      80 YLSNFCSNDCTYCGFSMKNKIKRKVLNEKEILRECEVILKQN-IKNILLVSGEHNKISGIDYLYKIISLIRKKFSSIAIE 158 Wigglesworthia ...
AAO75756      79 YITNSCTNSCVYCGFHISNPMKRTILTEEEIVNEYKAIKRLApFENLLLVTGENPAAAGVPYIARALDLAKPYFSNLQIE 158 Bacteroides the...
BAB81306      79 YISNYCVNKCSYCGYNVENKICRKKLNQEEIEKEGEAISKEG-FKHILILTGESEYHTPVEYIEESIKTLKEKFPSITIE 157 Clostridium per...
WP_002864289  81 YLSNYCNSKCVYCGFQKGNKIARAKLNEAEIHEEMQAIAKSG-LEEILMLTGEGREFASVEYIANACKIAREYFKVVGVE 159 Campylobacter j...
AAL93868     162 IYPVNVEDYKYLNSCGADYVTIFQETYNNEKYKKLHLEGHKKVFSYRFNSQERALMGGMRGVAFGALLGLDD-FRKDAFS 240 Fusobacterium n...
BAC61285     158 VQPLDQDEYAELKTLGLDAVMVYQETYHPKTYAQHHLRGNKMDFRYRLETPDRLAKAGIDKIGIGALIGLEE-WRTDCFF 236 Vibrio parahaem...
AAN55474     158 VQPLEESHYRKLVEQGLDAVMVYQETYQAETYAKHHTRGKKQDFAYRLATPDRVARAGVDKIGLGVLLGLDD-WRLDALM 236 Shewanella onei...
AAQ67066     160 VQPLTTEEYARLHEAGIGAVYVYQETYNEQAYPTYHPAGRKADYRYRLETPDRIGRANMQKIGIGALLGLEN-WRVDSVF 238 Porphyromonas g...
BAC24650     159 VQPLSTEEYKLLKKVGLDGVLVYQETYNIKSYKEHHIIGKKRDFFWRLSTPERIAKSNIEKIGLGILIGLSEnWRTDCYF 238 Wigglesworthia ...
AAO75756     159 VMPLKAEEYKELTHHGLNGVICFQETYHKANYKKYHPRGMKSKFEWRVNGFDRMGQAGVHKIGMGVLIGLEE-WRTDVTM 237 Bacteroides the...
BAB81306     158 IYPMTEEGYKKVVEAGAEGLTVYQETYDEKVYDRVHVAGPKKNYKFRLEAPERGAEAGMRSISIGALLGLAD-FRIDAFF 236 Clostridium per...
WP_002864289 160 IYPMNEDEYKILHEKGCDYVTVFQETYNPLKYSKIHLAGEKRIFPYRFNAQERALKAGMRGVAFAALLGIDD-FRKDALA 238 Campylobacter j...
AAL93868     241 TGYHAYLLQKKYPYAEISISCPRLRPVIN-----NLKVEKeIVTERELFQIVCAYRLFLPFANITISTRENSIFRDNIIK 315 Fusobacterium n...
BAC61285     237 AAAHLDYLERTYWQSRYSISFPRLRPCAGnapasGLQPKS-VMTDKQLVQLICAYRLFNPEVELSLSTRESPQFRDNVLP 315 Vibrio parahaem...
AAN55474     237 MGYHLDYLERHYWRTRFSISLPRLRPCTG-----GIAPKV-HLTDLGLVQMICTFRLFNQQLDISLSTREAPSLRDNLLP 310 Shewanella onei...
AAQ67066     239 TALHLRYLEQTYWKSKFSISLPRLRPATG-----GWEPKD-PIDDVGMVQLITAFRLLDKDVEISLSTRESREFRDHVMP 312 Porphyromonas g...
BAC24650     239 LMNHIFYLRKFFWKTNYSLSILRLRPCTN-----GISPKC-IINESDLLQIMCVFRILFPEIEISLSTRESKKFRDNISP 312 Wigglesworthia ...
AAO75756     238 MAYHLRYLQKHYWKTKYSVNFPRMRPSENd----GFQPNV-IMNDRELAQLTFAMRIFDHDVDISYSTRESAKIRNHMAT 312 Bacteroides the...
BAB81306     237 TAMHGKYLRDKYPHIDISYSVPRIRPCEG-----GLKKLN-EVDDRELVQILLAYRLFDPQGGINISTREGKDFRRNLIP 310 Clostridium per...
WP_002864289 239 TALHAHFLQQAYSHAEISISVPRLRPIIN-----NAKIHPkDVSEKRLLQVLCAYRLFLPFAGITISSRERIGFRDEVIK 313 Campylobacter j...
AAL93868     316 IAATKISAGVDTGIGAHTecSTKKGDEQFEIADKRTVAEIFEKVKSEDLQPVMNDYIYL 374 Fusobacterium nucleatum subsp. nucle...
BAC61285     316 LGITSMSAASKTQPGGYA--TEEVELEQFEISDERSAASVEDMIRAKGFDPVWRDWHSA 372 Vibrio parahaemolyticus RIMD 2210633
AAN55474     311 LGITQMSAGSSTQPGGYQ--VPDSQLDQFEISDDRTVEQVITQMRLKGFNPVFKDWESA 367 Shewanella oneidensis MR-1
AAQ67066     313 LGITSVSAGSKTEPGGYA--EENADLEQFAINDARSPAEMAADLRRLGYEPVWKDWDAF 369 Porphyromonas gingivalis W83
BAC24650     313 ILINNISAGSSTQPGGYS--TSKKELNQFEIQDNRSPREVSQELEKKGMNPVWKDWDYY 369 Wigglesworthia glossinidia endosymbi...
AAO75756     313 LGVTTMSAESKTEPGGYY--SYPQTLEQFHVSDERKAVEVERDLRKLGREPVWKDWDQS 369 Bacteroides thetaiotaomicron VPI-5482
BAB81306     311 LGVSKISAGVSTEVGGHS--LKEKGTSQFDINDESSVSEVKELIKSQGYQPIFKDWHRF 367 Clostridium perfringens str. 13
WP_002864289 314 LGATKMSAGVSVGIGEHK--GEKKGDEQFEISDDRSVDEILAMLKRSNLQAVMSDSIYV 370 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap