2ZDI


Conserved Protein Domain Family
gimC_beta

?
TIGR02338: gimC_beta 
Click on image for an interactive view with Cn3D
prefoldin, beta subunit, archaeal
Chaperonins are cytosolic, ATP-dependent molecular chaperones, with a conserved toroidal architecture, that assist in the folding of nascent and/or denatured polypeptide chains. The group I chaperonin system consists of GroEL and GroES, and is found (usually) in bacteria and organelles of bacterial origin. The group II chaperonin system, called the thermosome in Archaea and TRiC or CCT in the Eukaryota, is structurally similar but only distantly related. Prefoldin, also called GimC, is a complex in Archaea and Eukaryota, that works with group II chaperonins. Members of this protein family are the archaeal clade of the beta class of prefoldin subunit. Closely related, but outside the scope of this family are the eukaryotic beta-class prefoldin subunits, Gim-1,3,4 and 6. The alpha class prefoldin subunits are more distantly related.
Statistics
?
PSSM-Id: 131391
View PSSM: TIGR02338
Aligned: 10 rows
Threshold Bit Score: 81.6273
Threshold Setting Gi: 22256954
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZDI_A   4 IPPQVQAMLGQLDTYQQQLQLVIQQKQKVQADLNEAKKALEEIETLPDDAQIYKTVGTLIVKTT-KEKAVQELKEKIETL 82  Pyrococcus horikoshii...
O26774   3 LPQNVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVA-KDELTEELQEKLETL 81  Methanothermobacter t...
Q8TYC7   1 MAQNVEQQVAQLQQLQQQLSSIVAQKQQLELQLREIERALKELDEIEEDTKVYKTVGGLLIEAD-RDEVKEELEDRKETL 79  Methanopyrus kandleri...
Q8PZ21   5 LPPQIQNQIAQLQQVQQQVQALSMQKSQIEAMQKESKMALEELERLADDAVIYRSVGELVIKTT-KEESVSKLKDREETL 83  Methanosarcina mazei Go1
Q8U3S3   4 IPPQVQAMLGQLESYQQQLQLVIQQKQKVQADLNEAKKALEEIEKLTDDAVIYKTVGTLIVKTT-KEKALQELKEKVETL 82  Pyrococcus furiosus D...
O29115   4 LPPQVQNLVAQLQQLQQQLQAVITQRAQVEALLRDTEQALEELQKVDDETPVYKAVGNILVKEK-KEDVIKELTEKKETY 82  Archaeoglobus fulgidu...
Q9HSH0   5 LPPEAQEKLEQLQDLQEKAQNVATQKQQAEQQLSEAETALDALGDIEESTTMYREVGELLVETE-YDNAHDDLDEKVSDL 83  Halobacterium sp. NRC-1
Q975H2   5 IPPELQTQLVKLQQLQDQLNRLLTEKNVIDSELREVNKILQELSQLPAGTTVYKIVGNLLVKTD-KETVQKELDDRKEIL 83  Sulfolobus tokodaii s...
Q8ZVN4   4 IPPSLQDLVNRFNQAQAQLQNVLLRKQQYEAELKEVEKAISEIERLPQDAKIFKNVGNFLVPQS-RDVALQELRDRKELL 82  Pyrobaculum aerophilu...
Q979C4   6 ISSYLQNQLKQAQELEENIEKIATQRYQLDLSLKEIEKTLQELNKIDDKTPVYRSIGSILYKVDdKKKLIDELEEQLELT 85  Thermoplasma volcaniu...
2ZDI_A  83 EVRLNALNRQEQKINEKVKELTQKIQAALRP 113 Pyrococcus horikoshii OT3
O26774  82 QLREKTIERQEERVMKKLQEMQVNIQEAMKG 112 Methanothermobacter thermautotrophicus str. Delta H
Q8TYC7  80 ELRVKTLEKQEKRLQQQIENLQKRLQKALQQ 110 Methanopyrus kandleri AV19
Q8PZ21  84 SLRLQSISRQEERLTARFKQLQEQIQQALGP 114 Methanosarcina mazei Go1
Q8U3S3  83 EVRLNALNRQEQKINEKIKELTQKIQAALRP 113 Pyrococcus furiosus DSM 3638
O29115  83 EIRIKTLQRQEEKLRERFAETQQKLQNLLSP 113 Archaeoglobus fulgidus DSM 4304
Q9HSH0  84 EVRVETLQKQEDRVQEQFESLQEELQDMLGG 114 Halobacterium sp. NRC-1
Q975H2  84 ELRSRTYQKQENLLRTQLEDLQKKVNELLAK 114 Sulfolobus tokodaii str. 7
Q8ZVN4  83 ELHVKTLTRQESMLREQLDKLREEINKELAK 113 Pyrobaculum aerophilum str. IM2
Q979C4  86 KIRINTLDKQQKSLEEKYKELQAAIRERYNQ 116 Thermoplasma volcanium GSS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap