1EI6


Conserved Protein Domain Family
hydr_PhnA

?
TIGR02335: hydr_PhnA 
Click on image for an interactive view with Cn3D
phosphonoacetate hydrolase
This family consists of examples of phosphonoacetate hydrolase, an enzyme specific for the cleavage of the C-P bond in phosphonoacetate. Phosphonates are organic compounds with a direct C-P bond that is far less labile that the C-O-P bonds of phosphate attachment sites. Phosphonates may be degraded for phosphorus and energy by broad spectrum C-P lyase encoded by large operon or by specific enzymes for some of the more common phosphonates in nature. This family represents an enzyme from the latter category. It may be found encoded near genes for phosphonate transport and for pther specific phosphonatases.
Statistics
?
PSSM-Id: 131388
View PSSM: TIGR02335
Aligned: 4 rows
Threshold Bit Score: 723.227
Threshold Setting Gi: 39650655
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EI6_A     4 ISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICG 83  Pseudomonas fluores...
AAC15507   5 ISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICG 84  Pseudomonas fluores...
CAE29178   7 IEANGRSYAVPQRPVVVICLDGFDPEYLERGIADGVLPTIGALRSAGYVGTALATVPTTTNTNNTSIVTGVPPAIHGING 86  Rhodopseudomonas pa...
CAE31509   5 IALHGRHYALPQRPTVVVCIDGCDPEYIARGIADGVCPAIARFFEEGFGAVADCVMPSFTNPNNVSVVTGAPPAVHGIGG 84  Bordetella bronchis...
1EI6_A    84 NFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARV 163 Pseudomonas fluores...
AAC15507  85 NFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARV 164 Pseudomonas fluores...
CAE29178  87 NYYLDADTGEEIMVTDARRLRCGTILGAMSKAGVRTAVVTAKDKLLKVLAYEMDGIAFSSEHPNVADLTALGFKSGEELV 166 Rhodopseudomonas pa...
CAE31509  85 NYYLDRDTGREIMMTDAALLRGDTLLGLMSQAGVPTAAITAKDKLRKVLGHGLRGICFSSEKADQCSEAEHGVADVAALV 164 Bordetella bronchis...
1EI6_A   164 GMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGM 243 Pseudomonas fluores...
AAC15507 165 GMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGM 244 Pseudomonas fluores...
CAE29178 167 GRGRPDQYSADLSLFALDAGIRLMETAKPELIYLSTSDYVQHKYQPGEAESNDFHAAVDRRIARLIELGATVALTADHGM 246 Rhodopseudomonas pa...
CAE31509 165 GRPRPDMYSGDLSLYVLDAGLALLRQGRARLLYLSLSDYIQHKHAPGEPESDAFLRAIDTRLQAFVDAGAVVACIADHGM 244 Bordetella bronchis...
1EI6_A   244 NAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQ 323 Pseudomonas fluores...
AAC15507 245 NAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQ 324 Pseudomonas fluores...
CAE29178 247 ADKSRADGQPNVVYLEDALNETFGAGVARVICPIADPFVRHHGALGGFVRAHLLKPCDIAAMMTFARSLPGVELVLDRAT 326 Rhodopseudomonas pa...
CAE31509 245 SHKTDAQGRPNAIFLQDLLEARFGAGSARIICPITDPFVRHHGALGSFVRGYARNPADIEAMMQAAAAIDGVQEVLSREQ 324 Bordetella bronchis...
1EI6_A   324 ACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGL-TVPLRSHGGVSEQKVPLIFNRKLV----GLDSPGRLRNFDII 398 Pseudomonas fluores...
AAC15507 325 ACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGL-TVPLRSHGGVSEQKVPLIFNRKLV----GLDSPGRLRNFDII 399 Pseudomonas fluores...
CAE29178 327 VCERYQLPPDREGDFAVFTDRGTAVGARREDHDLSALgDHRLRSHGGLGEQRVPFVLSRPLKrdyrERAATGVLRNYDIF 406 Rhodopseudomonas pa...
CAE31509 325 AAQRLGLPLDREADFVVISHESYVLGSRADEHDLSTVgDHPLRSHGGYSEQPVPFFLSQPLSpayrERAAQGGLRNFDIF 404 Bordetella bronchis...
1EI6_A   399 DLALNHLA 406 Pseudomonas fluorescens
AAC15507 400 DLALNHLA 407 Pseudomonas fluorescens
CAE29178 407 DFALNGVD 414 Rhodopseudomonas palustris CGA009
CAE31509 405 DFALNGVQ 412 Bordetella bronchiseptica RB50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap