2H9F


Conserved Protein Domain Family
prpF

?
TIGR02334: prpF 
Click on image for an interactive view with Cn3D
probable AcnD-accessory protein PrpF
The 2-methylcitrate cycle is one of at least five degradation pathways for propionate via propionyl-CoA. Degradation of propionate toward pyruvate consumes oxaloacetate and releases succinate. Oxidation of succinate back into oxaloacetate by the TCA cycle makes the 2-methylcitrate pathway a cycle. This family consists of PrpF, an incompletely characterized protein that appears to be an essential accessory protein for the Fe/S-dependent 2-methylisocitrate dehydratase AcnD (TIGR02333). This protein is related to but distinct from FldA (part of pfam04303), a putative fluorene degradation protein of Sphingomonas sp. LB126. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131387
View PSSM: TIGR02334
Aligned: 6 rows
Threshold Bit Score: 730.482
Threshold Setting Gi: 114794281
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H9F_A         5 PPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFXRVIGSPDPYAAHIDGXGGATSSTSKCVILSKSSQPGHD 84  Pseudomonas aer...
BAC59908       9 MSQIKVPATYMRGGTSKGVFFNLEDLPSEAQVAGEARDKLLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSRSSRDDHD 88  Vibrio parahaem...
AAO28387       4 LPQCRIPATYLRGGTSKGVFFRLEDLPPACRVPGPARDALLLRVIGSPDPYGKQIDGMGGGTSSTSKVVIIAPSAYPNHD 83  Xylella fastidi...
WP_003114192   4 PPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFMRVIGSPDPYAAHIDGMGGATSSTSKCVILSKSSQPGHD 83  Pseudomonas aer...
WP_002224932   1 MPQIKIPAVYYRGGTSKGVFFKRSDLPEAAREAGSARDKILLRVLGSPDPYGKQIDGLGNASSSTSKAVILDKSERADHD 80  Neisseria menin...
AAM36014       4 LPQLRIPATYMRGGTSKGVFFRLQDLPTAAQQPGAARDALLLRVIGSPDPYAKQIDGMGGATSSTSKSVIVSASTRDGHD 83  Xanthomonas axo...
2H9F_A        85 VDYLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFE 164 Pseudomonas aer...
BAC59908      89 VDYLFGQVSIDKPFVDWSGNCGNLSAAVGSFAIHAGLIPQERILENGIVTVRVWQVNISKTILVHVPIVNGFVQETGEFE 168 Vibrio parahaem...
AAO28387      84 VDYLFGQVAIEGACVDWTGNCGNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVAHVPILDGQVQESGDFM 163 Xylella fastidi...
WP_003114192  84 VDYLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFE 163 Pseudomonas aer...
WP_002224932  81 VDYLFGQVSIDKPFVDWSGNCGNLTAAVGAFSIEQGLVDKGKIPSDGICTVKIWQKNIGKTIIAHVPMQNGAVLETGDFE 160 Neisseria menin...
AAM36014      84 VDYLFGQVSIDSAFVDWSGNCGNLSAAVGPFAIASGLIDPARVPRDGVATVRIWQANIGKTIVAHVPMTGGLVQETGDFE 163 Xanthomonas axo...
2H9F_A       165 LDGVTFPAAEIVLEFLDPSDd--GEdgGAIFPTGNLVDDLEVPGVGTFKATXINAGIPTVFVNAEEIGYRGTELREEING 242 Pseudomonas aer...
BAC59908     169 LDGVTFPAAEIQVDFVDPAD---GE--GSMFPTGNLVDDLVVPDVGTFNATFINAGIPTIFIDAESIGYQGTELQDQINN 243 Vibrio parahaem...
AAO28387     164 MEGAAFPGAEVRLEFLNPADv-gGD--RVMFPTGHLIDTLDVPGLGPIEATLINAGIPMLCVDAHALGYTGTELQEAING 240 Xylella fastidi...
WP_003114192 164 LDGVTFPAAEIVLEFLDPSDd--GEdgGAIFPTGNLVDDLEVPGVGTFKATMINAGIPTVFVNAEEIGYRGTELREEING 241 Pseudomonas aer...
WP_002224932 161 LDGVTFPAAEVQIEFLDPAD---GE--GSMFPTGNLVDEIDVPNIGRLKATLINAGIPTVFLNAADLGYTGKELQDDINN 235 Neisseria menin...
AAM36014     164 LDGVTFPAAEVQLEFLDPADdaeGDg-GAMFPTGNVIDQLEIPGLGTLDATLINAGIPTIFVNARDLGYTGTELQDAING 242 Xanthomonas axo...
2H9F_A       243 DPQQLARFERIRVAGALRXGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSXGKLHHAXXGTAA 322 Pseudomonas aer...
BAC59908     244 DDAALAMFESIRAHGALKMGLISDLEEAQTRQHTPKVAFVSKPKSYQSSSGKAVNESEIDVLVRALSMGKLHHAMMGTAA 323 Vibrio parahaem...
AAO28387     241 DPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVAAPADYVASGGRHVHATEIDVLVRAMSMGRLHHAMMGTAA 320 Xylella fastidi...
WP_003114192 242 DPQQLARFERIRVAGALRMGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSMGKLHHAMMGTAA 321 Pseudomonas aer...
WP_002224932 236 DAAALEKFEKIRAYGALKMGLISDVSEAAARAHTPKVAFVAPAADYTASSGKTVNAADIDLLVRALSMGKLHHAMMGTAS 315 Neisseria menin...
AAM36014     243 DPRALTMFETLRAHGAVRMGLIAKVEDAATRQHTPKVAFVAPPADYTASSRKPVHAAEIDLLVRAMSMGKLHHAMMGTAA 322 Xanthomonas axo...
2H9F_A       323 VAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIXSRSARILXEGWVRVPGDAF 396 Pseudomonas aeruginosa
BAC59908     324 VAIASAACVPGTLVNLAAGGGEKESVTFGHPSGTLKVGAQAKQTEQGWVVQKAIMSRSARILMEGFVRVPSDVF 397 Vibrio parahaemolytic...
AAO28387     321 VALGTAAAIPGTLVNRAAGGGLRRVVRFGHPSGTLQVGAEVHQVNGQWSVANVRMSRSARVLMEGCVRVPAESV 394 Xylella fastidiosa Te...
WP_003114192 322 VAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIMSRSARILMEGWVRVPGDAF 395 Pseudomonas aeruginosa
WP_002224932 316 VAIATAAAVPGTLVNLAAGGGTRKEVRFGHPSGTLRVGAAAECQDGQWTATKAVMSRSARVMMEGWVRVPEDCF 389 Neisseria meningitidis
AAM36014     323 VAIGTAAAVPGTLVNLAAGGAARSAVRFGHPSGTLRVGAQAQLVEGQWQVTKALMSRSARVLMEGWVRVPAPVA 396 Xanthomonas axonopodi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap