Conserved Protein Domain Family
2met_isocit_dHY

?
TIGR02333: 2met_isocit_dHY 
2-methylisocitrate dehydratase, Fe/S-dependent
Members of this family appear in an operon for the degradation of propionyl-CoA via 2-methylcitrate. This family is homologous to aconitases A and B and appears to act the part as 2-methylisocitrate dehydratase, the enzyme after PrpD and before PrpB. In Escherichia coli, which lacks a member of this family, 2-methylisocitrate dehydratase activity was traced to aconitase B (TIGR00117) ().
Statistics
?
PSSM-Id: 131386
View PSSM: TIGR02333
Aligned: 4 rows
Threshold Bit Score: 1834.23
Threshold Setting Gi: 488153723
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN67949       2 NTAYRKHLPGT----DLDYFDARAAVEAIKPGAYDGLPYTSRVLAENLVRR---CDPATLDASLSQLIERKRDLDFPWFP 74  Pseudomonas put...
AAN53428       6 NTQYRKPLPGT----ALDYFDTREAIEAIAPGAYAKLPYTSRVLAENLVRR---CEPEMLTASLKQIIESKQELDFPWFP 78  Shewanella onei...
WP_001087436   2 NSLYRKALSPSpaqsQVDFFDTRAAVEALKPGAYQTLPYTARILAENLVRR---CPPEQLSESLLQIIERKRDLDFPWYP 78  Vibrio cholerae
WP_002224931   4 NQRYRKPLPGT----DLEYYDARAACEDIKPGSYDKLPYTSRILAENLVNRadkVDLPTLQSWLGQLIEGKQEIDFPWYP 79  Neisseria menin...
AAN67949      75 ARVVCHDILGQTALVDLAGLRDAIADKGGDPAQVNPVVPVQLIVDHSLAVECGGFDPQAFEKNRAIEDRRNEDRFHFINW 154 Pseudomonas put...
AAN53428      79 ARVVCHDILGQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQLIVDHSLAVEYGGFDKDAFAKNRAIEDRRNEDRFHFINW 158 Shewanella onei...
WP_001087436  79 ARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVETQLIVDHSLAVEYSGCDPDAFEKNRAVEDRRNEDRFHFIEW 158 Vibrio cholerae
WP_002224931  80 ARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVQTQLIVDHSLAVECGGYDPDAFRKNREIEDRRNEDRFHFINW 159 Neisseria menin...
AAN67949     155 TKKAFKNVDVIQPGNGIMHQINLEKMSPVVHSDRGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRL 234 Pseudomonas put...
AAN53428     159 TQKAFKNIDVIPQGNGIMHQINLERMSPVIHARNGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRL 238 Shewanella onei...
WP_001087436 159 CKTAFKNVSVIPAGNGIMHQINLEKMSPVIQVKEGVAFPDSCVGTDSHTPHVDALGVLAIGVGGLEAETVMLGRPSMMRL 238 Vibrio cholerae
WP_002224931 160 TKTAFENVDVIPAGNGIMHQINLEKMSPVVQVKNGVAFPDTCVGTDSHTPHVDSLGVISVGVGGLEAETVMLGRASMMRL 239 Neisseria menin...
AAN67949     235 PEIVGVELTGKLAPNITATDLVLALTEFLRKQKVVGAYLEFHGEGARALTLGDRATISNMAPEYGATAAMFAIDQQTIDY 314 Pseudomonas put...
AAN53428     239 PDIIGVELTGKPQPGITATDIVLALTEFLRAQKVVSSYLEFFGEGAEALTLGDRATISNMTPEFGATAAMFYIDQQTLDY 318 Shewanella onei...
WP_001087436 239 PDIVGVKLTGARQPGITATDIVLALTEFLRRERVVSAYLEFFGEGAKALTIGDRATISNMTPEYGATAGMFYIDEQTIQY 318 Vibrio cholerae
WP_002224931 240 PDIVGVELNGKRQAGITATDIVLALTEFLRKERVVGAFVEFFGEGARSLSIGDRATISNMTPEFGATAAMFAIDEQTIDY 319 Neisseria menin...
AAN67949     315 LRLTGREEQQVKLVETYAKATGLWADSLGGAVYERTLSFDLSSVVRNMAGPSNPHARVATSDLAAKGIAGSWEE----VP 390 Pseudomonas put...
AAN53428     319 LTLTGREAEQVKLVETYAKTAGLWSDDLKQAVYPRTLHFDLSSVVRTIAGPSNPHARVPTSELAARGISGEVEN----EP 394 Shewanella onei...
WP_001087436 319 LKLTGREPEQVALVESYAKAAGLWADSLEHAEYERVLEFDLSSVERNLAGPSNPHRRLPTKDLSARGIAIPAQQreaqQA 398 Vibrio cholerae
WP_002224931 320 LKLTGRDDAQVKLVETYAKTAGLWADALKTAVYPRVLKFDLSSVTRNMAGPSNPHARFATADLAAKGLAKPYEE----PS 395 Neisseria menin...
AAN67949     391 -GQMPDGAVIIAAITSCTNTSNPRNVIAAGLIARNANKLGLTRKPWVKSSLAPGSKAVQLYLEEAGLEKELEQLGFGIVA 469 Pseudomonas put...
AAN53428     395 -GLMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANAKGLTRKPWVKTSLAPGSKAVQLYLEEANLLPELESLGFGIVG 473 Shewanella onei...
WP_001087436 399 eGLMPDGAVIIAAITSCTNTSNPRNVVAAGLLAKKANQLGLKRQPWVKTSFAPGSKVAKLYLQEAGLLSELEQLGFGIVA 478 Vibrio cholerae
WP_002224931 396 dGQMPDGSVIIAAITSCTNTSNPRNVVAAALLARNANRLGLKRKPWVKSSFAPGSKVAEIYLKEAGLLPEMEKLGFGIVA 475 Neisseria menin...
AAN67949     470 FACTTCNGMSGALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGV-VD 548 Pseudomonas put...
AAN53428     474 FACTTCNGMSGALDPVIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGLdKD 553 Shewanella onei...
WP_001087436 479 YACTTCNGMSGALDPAIQQEIIERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTMRFDIERDALGHdAQ 558 Vibrio cholerae
WP_002224931 476 FACTTCNGMSGALDPKIQKEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYALAGSIRFDIENDVLGV-AD 554 Neisseria menin...
AAN67949     549 GKEIRLKDIWPSDEEIDAVVRAAVKPEQFRKVYIPMFAIEeDRGPKVAPLYDWRPMSTYIRRPPYWEGALAGERTLRGMR 628 Pseudomonas put...
AAN53428     554 GKPVRLINIWPSDAEIDAVIAASVKPEQFRKVYEPMFDLSvDYGDKVSPLYDWRPQSTYIRRPPYWEGALAGERTLKGMR 633 Shewanella onei...
WP_001087436 559 GKPIYLNHLWPSDEEIDAVVGRAVKPEQFKQIYIQMFKLD-ETQSASSPLYDWRPMSTYIRRPPYWEGALAAPRTLKAMR 637 Vibrio cholerae
WP_002224931 555 GKEIRLKDIWPADEEIDAVVAEYVKPQQFRDVYVPMFDTG-TAQKAPSPLYDWRPMSTYIRRPPYWEGALAGERTLRGMR 633 Neisseria menin...
AAN67949     629 PLAVLPDNITTDHLSPSNAIMLDSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRN-DdGSVKQGS 707 Pseudomonas put...
AAN53428     634 PLAVLGDNITTDHLSPSNAIMMDSAAGEYLHKMGLPEEDFNSYATHRGDHLTAQRATFANPKLKNEMAIV-D-GKVKQGS 711 Shewanella onei...
WP_001087436 638 PLAILGDNITTDHLSPSNAILASSAAGEYLTKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKE-N-GQIKQGS 715 Vibrio cholerae
WP_002224931 634 PLAILPDNITTDHLSPSNAILAVSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKNeD-GSVRQGS 712 Neisseria menin...
AAN67949     708 LARIEPEGKVTRMWEAIETYMQRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 787 Pseudomonas put...
AAN53428     712 LARIEPEGIVTRMWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 791 Shewanella onei...
WP_001087436 716 LARIEPEGKVTRMWEAIETYMNRKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFK 795 Vibrio cholerae
WP_002224931 713 FARVEPEGETMRMWEAIETYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLQFK 792 Neisseria menin...
AAN67949     788 PGTDRKTLGLDGSETYDVLGARTPRATLTLVVTRANGECLEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLE 859 Pseudomonas putida KT2440
AAN53428     792 AGENRATYGIDGTEVFDVIGSIAPRADLTVIITRKNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLE 863 Shewanella oneidensis MR-1
WP_001087436 796 PGVNRHSLALDGTELFDVVGEIRPGADLALVVTRQNGEKLDVAVTCRLDTADEVHVYQAGGVLQRFAQDFLA 867 Vibrio cholerae
WP_002224931 793 PDTNRHTLQLDGTETYDVVGERTPRCDLTLVIHRKNGETVEVPVTCCLDTAEEVLVYEAGGVLQRFAQDFLE 864 Neisseria meningitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap