Conserved Protein Domain Family
HpaX

?
TIGR02332: HpaX 
4-hydroxyphenylacetate permease
This protein is a part of the Major Facilitator Superfamily (pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. ( as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.
Statistics
?
PSSM-Id: 131385
View PSSM: TIGR02332
Aligned: 2 rows
Threshold Bit Score: 746.425
Threshold Setting Gi: 30043853
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR11359  28 VIKKLFRRLIVFLFVLFIFSFLDRINIGFAGLTMGRDLGLSATMFGLATTLFYAAYVIFGIPSNIMLSIVGARRWIATIM 107 Escherichia coli
AAP19572  20 VINKLFRRLIIFLFILFVFSFLDRINIGFAGLTMGKDLGLTSTMFGLAATLFYVTYVMCGIPSNMMLAKIGARRWIAGIM 99  Shigella flexneri 2...
AAR11359 108 VLWGIASTATMFATGPTSLYVLRILVGITEAGFLPGILLYLTFWFPAYFRARANALFMVAMPVTTALGSIVSGYILSLDG 187 Escherichia coli
AAP19572 100 VVWGIASTCTMFATSPETLYLLRMLVGIAEAGFLPGILVYLTWWFPAYHRARANALFMIAMPVTMMLGLILSGYILALDG 179 Shigella flexneri 2...
AAR11359 188 VMALKGWQWLFLLEGFPSVLLGVMVWFWLDDSPDKAKWLTKEDKKCLQEMMDNDRltlVQpegAISHHAMQqRSMWREIF 267 Escherichia coli
AAP19572 180 LWNLKGWQWLFLLEGLPSVILGVVTWFYLNDTPDQATWLDENEKQALKTMILREQ---ES---AFAHASVP-RSTLREVL 252 Shigella flexneri 2...
AAR11359 268 TPVVMMYTLAYFCLTNTLSAISIWTPQILQSFNQGSSNITIGLLAAVPQICTILGMVYWSRHSDRRQERRHHTALPYLFA 347 Escherichia coli
AAP19572 253 TPAIMLYTLAYFCLTNTLSAINIWTPQILQSFNTGSSNIMIGLLAAIPQFCTIFGMIWWSRRSDRLKERKKHTILPYLFA 332 Shigella flexneri 2...
AAR11359 348 AAGWLLASATDHNMIQMLGIIMASTGSFSAMAIFWTTPDQSISLRARAIGIAVINATGNIGSALSPFMIGWLKDLTGSFN 427 Escherichia coli
AAP19572 333 AAGWLLASATDHSLIQLSSIIMASMGSFTAMTIFWTTPDQVISLQSRAVAMAVINAVGNVGSAVSPLLIGILKDATGSFS 412 Shigella flexneri 2...
AAR11359 428 SGLWFVAALLVI 439 Escherichia coli
AAP19572 413 SGLWFVAGLLVL 424 Shigella flexneri 2a str. 2457T
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap