1SZQ


Conserved Protein Domain Family
prpD

?
TIGR02330: prpD 
Click on image for an interactive view with Cn3D
2-methylcitrate dehydratase
Members of this family are bacterial proteins known or predicted to act as 2-methylcitrate dehydratase, an enzyme involved in the methylcitrate cycle of propionate catabolism. A related clade of archaeal proteins that may or may not be functionally equivalent is reserved for a future model and is excluded from this family. The PrpD enzyme of E. coli is responsible for the minor aconitase activity (AcnC) not accounted for by AcnA and AcnB.
Statistics
?
PSSM-Id: 131383
View PSSM: TIGR02330
Aligned: 5 rows
Threshold Bit Score: 876.484
Threshold Setting Gi: 48425743
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SZQ_A          13 DREIVDIVDYVXNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKKLLGPIVPG-TVVPNGVRVPGTQFQLDPVQAAFN 91  Escherichia coli
AAP76996        16 DELLSKIARYALEFEINSPLAYETARYCLMDTIGCGLLALNFPACTKLLGPVVEGaEFRPLGAKIPGTSYQLEPERAAFN 95  Helicobacter ...
P77243          13 DREIVDIVDYVMNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKKLLGPIVPG-TVVPNGVRVPGTQFQLDPVQAAFN 91  Escherichia c...
WP_003103059    14 DAVLQDIADYVLDYRIDSTEALDTARNCLMDTLGCGLLALRFPECTKHLGPLVEG-TLVPHGARVPGTSFRLDPVKAAWD 92  Pseudomonas
tigr:GBAA_2349  11 DAILEEITDYVLNKEVTSAEAFSTARYVLFDTLGCGILALQYPECTKLLGPVVPG-TIVPNGTRVPGTSYVLDPVKGAFN 89  Bacillus anth...
1SZQ_A          92 IGAXIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTXKQVLTAXIKAHEIQGCIALENSFNRVGLDH 171 Escherichia coli
AAP76996        96 VGAMVRWLDFNDTWLAAEWGHPSDNLGAIWAVADYLSRKNIAQGKEPLRVKDVLSAMIKAHEIQGILALENCFNKVGLDH 175 Helicobacter ...
P77243          92 IGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALENSFNRVGLDH 171 Escherichia c...
WP_003103059    93 IGCIVRWLDYNDTWLAAEWGHPSDNLGGILAVADHLSQKRLANGEAPLSMRQVLEAMIMAHEIQGVIALENSFNRVGLDH 172 Pseudomonas
tigr:GBAA_2349  90 IGCMIRWLDYNDTWLAAEWGHPSDNLGGILAVADYISRVRISEGKEPLKVREVLEMMIKAHEIQGVLALENSLNRVGLDH 169 Bacillus anth...
1SZQ_A         172 VLLVKVASTAVVAEXLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALXAKTGEXGYPSALT 251 Escherichia coli
AAP76996       176 VLLVRIASTAVACAMLGGNFEEVRNAISHAFIDGGALRTYRHAPNTGSRKSWAAGDASSRGVNLALKALSGEMGYPSALS 255 Helicobacter ...
P77243         172 VLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALMAKTGEMGYPSALT 251 Escherichia c...
WP_003103059   173 VLLVKVASTAVCAKLMGADREQLLAALSHAFVDGQALRTYRHAPNAGSRKSWAAGDATSRGVRLADIALRGEMGIPGVLS 252 Pseudomonas
tigr:GBAA_2349 170 VLYVKVATTAVVAKMLGGTREEIFNALSHAWIDNSSLRTYRHAPNTGSRKSWAAGDATSRGVHLAMTALKGEMGYPTALS 249 Bacillus anth...
1SZQ_A         252 APVWGFYDVSFKGE------------SFRFQRPYGSYVXENVLFKISFPAEFHSQTAVEAAXTLYEQXQAAgktAADIEK 319 Escherichia coli
AAP76996       256 ASFWGFEDVKMKGQ------------KLTIPQEFGSYVMENVLFKISFPAEFHAQTAVECAIKLHNEVKNR---LDEIER 320 Helicobacter ...
P77243         252 APVWGFYDVSFKGE------------SFRFQRPYGSYVMENVLFKISFPAEFHSQTAVEAAMTLYEQMQAAgktAADIEK 319 Escherichia c...
WP_003103059   253 APQWGFYDVLFSHTskdlatkpedkrRFSFPQGYGSYVMENVLFKISFPAEFHAQTAAEAAVRLHPLVKDR---LQRISR 329 Pseudomonas
tigr:GBAA_2349 250 APGWGFQDVLFNKQ------------ELKLARPLESYVMENVLFKVSYPAEFHAQTAAECAVKLHPEIKER---LDEIDR 314 Bacillus anth...
1SZQ_A         320 VTIRTHEACIRIIDKKGPLNNPADRDHCIQYXVAIPLLFGRLTAADYEDN-VAQDKRIDALREKINCFEDPAFTADYHDP 398 Escherichia coli
AAP76996       321 IVITTQESGHRIINKVGPLANPADRDHCIQYMVAVPLVFGRLTAEDYEDS-VASDPRIDSLRDKMSVEVDDRYTREYLES 399 Helicobacter ...
P77243         320 VTIRTHEACIRIIDKKGPLNNPADRDHCIQYMVAIPLLFGRLTAADYEDN-VAQDKRIDALREKINCFEDPAFTADYHDP 398 Escherichia c...
WP_003103059   330 IVITTHESAIRIISKVGPLANPADRDHCLQYMTAVPLIFGDLVAEHYEDAfHAAHPLIDRLREKMEIVEEPRYSREYLEA 409 Pseudomonas
tigr:GBAA_2349 315 ITITTHESAIRIIDKEGPLNNPADRDHCLQYITAIGLLKGDIVADDYEDA-VANDPRVDELRNKMVVVENKQYSLDYLDP 393 Bacillus anth...
1SZQ_A         399 EKRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDRARLEQXPVNEYL 478 Escherichia coli
AAP76996       400 DKRSIANAVQIFYKDGSKSQKVEVEYPIGHKRRRDEGIPVLVDKFKRNIALKLSSKKCALIEKLCSDQKTLESTPFNEFS 479 Helicobacter ...
P77243         399 EKRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDRARLEQMPVNEYL 478 Escherichia c...
WP_003103059   410 DKRSIANAVEVFFDDGSSTGQVAVEYPLGHRRRRAEGIPLLQEKFKANLATRFPPQRCQRIFDLCSHQASLEATPVNRFM 489 Pseudomonas
tigr:GBAA_2349 394 NKRSIANAVQVHFKDGTVTENVECEYPLGHRFRRDEAIPKVVQKFTASMAGHYSSKQQEQIHEVCLNEEKLENMNVNEFV 473 Bacillus anth...
1SZQ_A         479 DLYVI 483 Escherichia coli
AAP76996       480 DLFAL 484 Helicobacter hepaticus ATCC 51449
P77243         479 DLYVI 483 Escherichia coli K-12
WP_003103059   490 DLLAI 494 Pseudomonas
tigr:GBAA_2349 474 DLFLI 478 Bacillus anthracis str. 'Ames Ancestor'
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap