Conserved Protein Domain Family
TIGR02328

?
TIGR02328: TIGR02328 
conserved hypothetical protein
Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131381
View PSSM: TIGR02328
Aligned: 4 rows
Threshold Bit Score: 215.083
Threshold Setting Gi: 499267490
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD65652       4 MRLWHEQLIHQLPRQQLLGQHRELAALRGNGWGKNHATVNYVFKYSPYKLYQFHVLVMDEMQLRGYHPNKIWYDPNYRGQ 83  Lactobacillus p...
CAD46550       1 MRLWHQDIIELLPRQQLLGQHRECCALRGNGWGRKHETVDYVFRYSPYRLFAYHQLVMEEMMERGYRVSKEWLIAEYRGM 80  Streptococcus a...
WP_003130762   6 MRLWHEALIKKLPRQQLLGQHRECCALRGKGWGKPHSTVNYVFNYSPYKLFQYHLQVMTEMRKRGYHPDEKWLNPLYRGQ 85  Lactococcus lactis
WP_010964883   1 MRLWHQSLITKLPRQQLLGQHRECCALRGNAWGKKHSVVDYVFCHPMEYLVAYHLLVMEEMATRNYNVSDQWMDYNYRGK 80  Clostridium ace...
CAD65652      84 FCP----PYDHLTPIALTTPIYPEHNASYLAECVRNLAAKGIIM 123 Lactobacillus plantarum WCFS1
CAD46550      81 KCP----RYDTLNPVDLETPIYPEHNQDYLQECLWNLKAKGIDL 120 Streptococcus agalactiae NEM316
WP_003130762  86 TSK----VYLELEEVIQTFPIYPEHNNDYLEDCKENLREKGIII 125 Lactococcus lactis
WP_010964883  81 NCEkanlNFELIEEIKASKNIYKEHDDEYLNECLANLRNKGIEL 124 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap