1M32


Conserved Protein Domain Family
transamin_PhnW

?
TIGR02326: transamin_PhnW 
Click on image for an interactive view with Cn3D
2-aminoethylphosphonate--pyruvate transaminase
Members of this family are 2-aminoethylphosphonate--pyruvate transaminase. This enzyme acts on the most common type of naturally occurring phosphonate. It interconverts 2-aminoethylphosphonate plus pyruvate with 2-phosphonoacetaldehyde plus alanine. The enzyme phosphonoacetaldehyde hydrolase (EC 3.11.1.1), usually encoded by an adjacent gene, then cleaves the C-P bond of phosphonoacetaldehyde, adding water to yield acetaldehyde plus inorganic phosphate. Species with this pathway generally have an identified phosphonate ABC transporter but do not also have the multisubunit C-P lysase complex as found in Escherichia coli. [Central intermediary metabolism, Phosphorus compounds]
Statistics
?
PSSM-Id: 131379
View PSSM: TIGR02326
Aligned: 6 rows
Threshold Bit Score: 665.714
Threshold Setting Gi: 489203269
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M32_A         2 SRNYLLLTPGPLTTSRTVKEAXLFDSCTWDDDYNIgVVEQIRQQLTALATASEG-YTSVLLQGSGSYAVEAVLGSALG-P 79  Salmonella ente...
CAD63312       2 KQPYLLLTPGPLSTTASVKDAMQIDYCTWDSDYRH-VTETIRQQILAMAQANPEnYTTVLLQGSGSFGVEATIGTAVPrT 80  Lactobacillus p...
jcvi:BA_1341   3 ENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYNT-MVQKVRAKLVSLATKEEEkYTTVLMQGSGTFSVEAVIGSVIP-K 80  Bacillus anthra...
WP_000203965   3 SRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIgVVEQIRQQLTALATASEG-YTSVLLQGSGSYAVEAVLGSALG-P 80  Salmonella ente...
WP_003112368   5 ERAPILLTPGPLTTSYRTRRAMMVDWGSWDSDFNE-LTASVCQRLLKIVGGEGS-HTCVPLQGSGTFAVEAAIGTLVP-R 81  Pseudomonas aer...
BAC96502       6 KNEYLLLTPGPLSTSETVREAMLKDWCTWDDEYNKdIVEVIRTKLVKLATKHSG-YTSVLMQGSGTASVEATIGSAIG-K 83  Vibrio vulnific...
1M32_A        80 QDKVLIVSNGAYGARXVEXAGLXGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAXVHSETTTGXLNPIDEVGALAHR 159 Salmonella ente...
CAD63312      81 DATLMIAINGAYGHRISQIAEYYDIPHIDVVFNEDEAVDPVRIEATLADHPEITHFATVHSETTTGILNPIEALMPIMHE 160 Lactobacillus p...
jcvi:BA_1341  81 NGKLLVCTNGAYGKRIVQMAEMLHIDVVVSQTEEWEPTNIVEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQ 160 Bacillus anthra...
WP_000203965  81 QDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPNVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHR 160 Salmonella ente...
WP_003112368  82 DGKVLVLINGAYGKRLAKICEVLQRPFSTLETEENVPTTAADVERLLAADPAISHVALIHCETSTGILNPLEAIAKVVER 161 Pseudomonas aer...
BAC96502      84 EGKLLVVDNGAYGARIAQIAAYLNIPCHVVSPGETSQPHLNEVETALASDPAITHVAIVHCETTTGMLNPIEAFASVAKA 163 Vibrio vulnific...
1M32_A       160 YGKTYIVDAXSSFGGIPXDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLYAQWRCXEDNHGKW 239 Salmonella ente...
CAD63312     161 HGIVTIIDAMSSLGGVPISIDELDCDYLISSANKCVKGVPGFAFIIAKQATLAHTADNARSLCLDLYDQWQAMTKQPGKW 240 Lactobacillus p...
jcvi:BA_1341 161 YGKVTLVDAMSSFGGIEIDIAELQIDFLISSANKCIQGVPGFGFVIAQRDELLKCKGQARSLSLDLYDQWETMENQNGKW 240 Bacillus anthra...
WP_000203965 161 YGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSLSLDLYAQWRCMEDNHGKW 240 Salmonella ente...
WP_003112368 162 HGKRLIVDAMSSFGAIGIDARKVPFDALIAASGKCLEGVPGMGFVFARSAALEASAGNCHSLAMDLQDQHAYMR-KTGQW 240 Pseudomonas aer...
BAC96502     164 HGKVVILDAMSSFGGIPIDIAELGIDFMISSANKCIQGVPGFGFVIAKQTELEKCQGQARSLSLDLYDQWHCMEVNHGKW 243 Vibrio vulnific...
1M32_A       240 RFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITAFYSPEdPQYRFSEFYRR 319 Salmonella ente...
CAD63312     241 RFTSPTHVVHAFAQALIELQAEGGVTPRYQRYRASQQLLSDGLQALGFELVIDPAIQGPIITSFKYPN-VDFDFADFYQF 319 Lactobacillus p...
jcvi:BA_1341 241 RFTSPTHVVHAFYQALLELEKEGGVRARYNRYYNNQKLLVNRMGEIGFKPLVNEKYQSPIITSFIYPEg-NFEFQQLYNE 319 Bacillus anthra...
WP_000203965 241 RFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITAFYSPEdPQYRFSEFYRR 320 Salmonella ente...
WP_003112368 241 RFTPPTHVVAALHEALSQYEEEGGLPARQRRYASNCETLLGEMARLGFRSFLPAEIQAPIIVTFHAPRdPRYRFADFYQR 320 Pseudomonas aer...
BAC96502     244 RFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQKTLVAGMRSLGFEPLLSDDLHSPIITSFYSPThSDYQFKAFYTR 323 Vibrio vulnific...
1M32_A       320 LKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAXYWT 365 Salmonella enterica subsp. enterica serovar Typhi...
CAD63312     320 IKQRGFVIYPGKVSNIPSFRIGTIGDVDTTDIQRLLTIIGDYQQLH 365 Lactobacillus plantarum WCFS1
jcvi:BA_1341 320 LKRYGFVIYPGKISKVDTFRIGNIGDVHEEDINRLVDSIAKGVVIG 365 Bacillus anthracis str. Ames
WP_000203965 321 LKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWT 366 Salmonella enterica
WP_003112368 321 VREKGFILYPGKLTQVETFRVGCIGHVDAAEMRQAVAAIGEALREL 366 Pseudomonas aeruginosa
BAC96502     324 LKEQGFVIYPGKVSNADCFRIGNIGEVYPADIERLIGAIEKAMYWQ 369 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap