Conserved Protein Domain Family
CP_lyasePhnL

?
TIGR02324: CP_lyasePhnL 
phosphonate C-P lyase system protein PhnL
Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Statistics
?
PSSM-Id: 131377
View PSSM: TIGR02324
Aligned: 8 rows
Threshold Bit Score: 338.982
Threshold Setting Gi: 489209538
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAQ59515       4 LIDAQNLSKTFTLHQQGGLRLPVLTEVSLQAAAGECVALAGPSGAGKSTLLKALYANYLVENGRVG--VL-HQGAWVDMA 80  Chromobacterium...
BAC46491       8 MIDVTDAKKTFTMHLQGGIELPVVSGVTFQVNPGECVVLSGPSGAGKSSILKMIFGNYRCDSGRIG--IR-HRGALIDLA 84  Bradyrhizobium ...
BAB54544       4 RLHAKGLAKTFTLHTQGGTILPVFDNIELAVKAGECVCLHGPSGAGKSTLLRSLYANYKPDAGKIL--VQ-HIGDTVDLL 80  Mesorhizobium l...
AAO56069       4 LIEVRDLSKTFTLHQHNGVVLNVLRGLSFSVRSGECLMLSGQSGAGKSTLLRTLYGNYLPAAGSIR--VQ-HEGEWTELV 80  Pseudomonas syr...
WP_010996375  18 LLQVENLRKSFILHQQGGMNLSVLEDVSLSVNAGECVALSGASGSGKSTFMRCLYANYRVDSGSVW--VR-HEESWLDLC 94  Nostoc sp. PCC ...
WP_000611405   1 MINVQNVSKTFILHQQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQ--IK-HGDEWVDLV 77  Enterobacteriaceae
WP_011065376   3 LLEVSDFGKQFINHRLQ-VKRQAVKNIHFTLEEGQFLGIIGKSGSGKSTILKSIYRTYLPDQGTIYfdSN-HLGK-IDIT 79  Oceanobacillus ...
WP_003118408   5 ILKIEGLSKQFQLHDQN-KLIPSCAQVQLEVFAGELTALIGPTGAGKSSVLKAIYRTYLPSSGRIL--YRdANGAITDLA 81  Pseudomonas aer...
AAQ59515      81 RALPHEIAAVRRHTLGYVSQFLRVIPRVSALDIVTEPLREWGAADAEARLAAGEWLARLNIAERLWSLPPATFSGGEQQR 160 Chromobacterium...
BAC46491      85 TAEPRQVLNVRRATIGYVSQFLRAVPRVATIDVVAEPLIVNGMARTEAQQRAGALLHRLNIPERLWQLPPATFSGGEQQR 164 Bradyrhizobium ...
BAB54544      81 AAEPWEVVEIRRRTIGYVSQFLRVIPRVPTLDIVAEPAIVNGVPPEKAHAAARALLSRLRIPERLWSLAPATFSGGEQQR 160 Mesorhizobium l...
AAO56069      81 GATPRQVLEVRRKTLGYVSQFLRVIPRVSSLDVLMEPALARGWSREQAQARAQLLLTRLNIPQRLWPLAPSTFSGGEQQR 160 Pseudomonas syr...
WP_010996375  95 QLAPHEILAVRQKTIGYVSQFLRVIPRVPALEVAAEPLLELGINIDVAYNKVKDLFRRLNLSERLWHLSPTTFSGGEKQR 174 Nostoc sp. PCC ...
WP_000611405  78 TAPARKVVEIRKTTVGWVSQFLRVIPRISALEVVMQPLLDTGVPREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQR 157 Enterobacteriaceae
WP_011065376  80 KISEREMIYLRKFEISYVSQFLDVLPRITCRELVEKSLQEMGVEHAIARVEAESALNHFEIDEKLWDVYPNTFSGGEKLR 159 Oceanobacillus ...
WP_003118408  82 QASEHRMLELRKQDLGFVTQFLHCLPRKSAVEVVAEPLVQRGSPREAAAERARELLALLNVPERLWAVPPATFSGGEKQR 161 Pseudomonas aer...
AAQ59515     161 VNIARGMIAPRPILLL-DEPTASLDAANREVVVQLMREALARRAALIGIFHD-APTRDAI-ATR--VF-QVPL 227 Chromobacterium violac...
BAC46491     165 VNIARGFISDLPILLL-DEPTASLDAANRAVVVELIAEKKRQGVAMVAIVHD-DEIRHLI-ADR--IV-DVTS 231 Bradyrhizobium diazoef...
BAB54544     161 VNIARSFIADYPVLLL-DEPTASLDATNRQTVIELINEAKARGAAIVGIFHD-EEVREAV-ADR--LF-EVTP 227 Mesorhizobium loti MAF...
AAO56069     161 INIARAFMVPWPVLLL-DEPTASLDDANRKVVLELVAEAKQAGAALIGIFHD-RDARESV-ADR--QL-DMTP 227 Pseudomonas syringae p...
WP_010996375 175 VNITRALAVDYPILLL-DEPTSALDTTNRQVVIELLQEKKAQGCALIGIFHD-EEVKAQL-CNR--EL-IFKS 241 Nostoc sp. PCC 7120
WP_000611405 158 VNIARGFIVDYPILLL-DEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHD-EAVRNDV-ADRlhPM-GASS 226 Enterobacteriaceae
WP_011065376 160 LNIAMATVK-QPRLLLlDEPTASLDQNSKIKVREVIEKLKHSGTTLIGIFHDiEFIEGLCdSIF--NMnDHQP 229 Oceanobacillus iheyensis
WP_003118408 162 VNLARGLIARPRLLLL-DEPTASLDPSTTDRVVELLKSIKAEGVAMLAIFHD-PELVRRL-ADR--VV-TLTP 228 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap