2DUA


Conserved Protein Domain Family
Pphn_pyruv_hyd

?
TIGR02321: Pphn_pyruv_hyd 
Click on image for an interactive view with Cn3D
phosphonopyruvate hydrolase
This family consists of phosphonopyruvate hydrolase, an enzyme closely related to phosphoenolpyruvate phosphomutase. It cleaves the direct C-P bond of phosphonopyruvate. The characterized example is from Variovorax sp. Pal2.
Statistics
?
PSSM-Id: 131374
View PSSM: TIGR02321
Aligned: 3 rows
Threshold Bit Score: 459.19
Threshold Setting Gi: 116667098
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DUA_A     1 MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIA 80  Variovorax sp. Pal2
AAO24736   1 MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIA 80  Variovorax sp. Pal2
CAE31545   1 MTKNRSLRAALESGQLFTAMAAHNPLAARLAEEAGFGGIWGSGFELSASYAVPDANILSMGTHLEMMRAIAATVSIPLIA 80  Bordetella bronchis...
2DUA_A    81 DIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSLRTDGRQELVRIEEFQGKIAAATAARADRDFVVIARVEALI 160 Variovorax sp. Pal2
AAO24736  81 DIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSLRTDGRQELVRIEEFQGKIAAATAARADRDFVVIARVEALI 160 Variovorax sp. Pal2
CAE31545  81 DIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSLRAEGRQELVRIEEFQGKVAAAAAARKDPDFVVIARVEALI 160 Bordetella bronchis...
2DUA_A   161 AGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIR 240 Variovorax sp. Pal2
AAO24736 161 AGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIR 240 Variovorax sp. Pal2
CAE31545 161 AGQGQDEAIRRGLAYEEAGADAILIHSKQKTPDEILAFVAAWPGRKPLVLVPTAYPQLGERDIAALGKVGVVIYGNHAIR 240 Bordetella bronchis...
2DUA_A   241 AAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK 290 Variovorax sp. Pal2
AAO24736 241 AAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK 290 Variovorax sp. Pal2
CAE31545 241 AAVGAMREVFAQIRRDQGIGQADRGLPTVKEIIALQGDARMREIEARYLK 290 Bordetella bronchiseptica RB50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap