Conserved Protein Domain Family
phosphono_phnM

?
TIGR02318: phosphono_phnM 
phosphonate metabolism protein PhnM
This family consists of proteins from in the PhnM family. PhnM is a a protein associated with phosphonate utilization in a number of bacterial species. In Pseudomonas stutzeri WM88, a protein that is part of a system for the oxidation of phosphites (another form of reduced phosphorous compound) scores between trusted and noise cutoffs. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131371
View PSSM: TIGR02318
Aligned: 10 rows
Threshold Bit Score: 491.079
Threshold Setting Gi: 14022858
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC12929       4 VIHNGNIIMEDSILTDhAVVIEGDRIKDVITEEEAIQLSnvefINANGGFISPGFIDIHSDYIESIVSPRPTSMMD-MDI 82  Oceanobacillus ...
CAD31338      22 TLTGARLVLPDEVYDG-TVHIIDGYIDDIAAGRSTVPGA----IDLEGGYVTPGLIDLHTDNSEKHALPRAGVVWN-HLS 95  Mesorhizobium l...
BAB54655       4 QISNARIVCEDHLVEA-GLAICDGLIDCFEQGGTSKAEA----IDFDGDFLLPGLIDLHTDSVEHFMQPRPGVQWPsPLA 78  Mesorhizobium l...
CAE26133       2 VLGNAWLVLADRVIEHgWVAIADGVIAEVGEGD-APNGA----KDMHGDLVMPGLVELHTDHLEAHYTPRPKVQWN-PVA 75  Rhodopseudomona...
P16689         2 IINNVKLVLENEVVSG-SLEVQNGEIRAFAESQSRLPEA----MDGEGGWLLPGLIELHTDNLDKFFTPRPKVDWP-AHS 75  Escherichia col...
CAE26146       5 AIEGGRTLVGDEIAEG-SLQIAGGAIAVVGSASGQAAIR----IDARGLLVLPGIVDLHGDAFERQMMPRPGVDFP-IDV 78  Rhodopseudomona...
BAB49466       2 WLSEFEIVLRDRVIPNgAVRIEDGRIAEIRDRPVAHAD-----IDGGGRLLLPGFIDMHGDMVEREVEPRIGVHVP-MRI 75  Mesorhizobium l...
CAB46523       2 WLSNFTLVLPNEVVSEgSVRVEDGAIAEIRPEPVAGAA-----IDGGGRLLMPGFVDLHGDMIEREIAPRPNATMP-IDF 75  Rhizobium legum...
WP_010996374   5 IYTNYRLQLPDQELLG-TLVVRDGLIADIQPG--ILTHG----QNGEGDYLLPGLIELHTDNLERCMSPRPGIRWP-LEA 76  Nostoc sp. PCC ...
WP_010970699   5 ALSNARIVLEDDIILG-SVLIRDGKIADISEG--ASKTG----EDLEGDFLIPGLVELHTDHLEQHYSPRPGVIWD-KIA 76  Agrobacterium f...
BAC12929      83 SLREAEKILISHGITTMFHSLSFYkkdlFTHKPIRNPENVQRLVEAIHETHDRP-HLIRHRLHARFELDNIEQIEQLVEN 161 Oceanobacillus ...
CAD31338      96 AVMAHDALVIAAGITTVFDSLCIGsttrDHTRQADRARILPVLIDGIREARAHGlLRADHFLHLRCEVTDEEVMSVFTPL 175 Mesorhizobium l...
BAB54655      79 AVLAHDWQLLGSGITTVLDALALG----DYDSGGTRTAMLNDAIDGLTQARASGlLKTDHYFHFRCELSDPALLPIVERH 154 Mesorhizobium l...
CAE26133      76 AVVSYDGQLATCGITTVLDSLRVW----REEGAEEVDGQAIVLAGAISTARDAQlLRADHFLHLRCEIPMPNVVAEAKEL 151 Rhodopseudomona...
P16689        76 AMSSHDALMVASGITTVLDAVAIG----DVRDGGDRLENLEKMINAIEETQKRGvNRAEHRLHLRCELPHHTTLPLFEKL 151 Escherichia col...
CAE26146      79 ALIDSDRQAIANGLTTVFHAVTWS-----WEPGLRSADNARRMLDAIDLTKPR--LSADTRIHLRHETFNLDAVDEIAQW 151 Rhodopseudomona...
BAB49466      76 GIAELDKKLASCGITTAYAALSFIga-sVTSGVLRSEDHTTEIIDTIAGMKDH--LLVDHRTHARFEVTFTPAIPTLQKL 152 Mesorhizobium l...
CAB46523      76 GIHELDKKLAAAGVTTAFAPSPLRprasTAMSVRWRPPPQCSRASIACGMICC--SITAFTPVT--KSPMSGQLPRLSAW 151 Rhizobium legum...
WP_010996374  77 AAVYHDRDLASAGVTTVCDAIAIG----DVAVGSPRLTNYAPMIDVISQGQAAGrFCVEHRIHLRCELAYEEVYEITAEY 152 Nostoc sp. PCC ...
WP_010970699  77 AIQAHDAQVASSGITTVFDCLRLG----SDEDGGFKKGEMREMADAIEAAADQNrLRADHLLHLRCEVASADVLEHFEDF 152 Agrobacterium f...
BAC12929     162 IENDKVHLLSFMDHTPGQGQYRDLEVFSKTLKGY-RN--LSDDEVNVIILERKSREQMT---LEKIAEVAKIADNKGIAV 235 Oceanobacillus ...
CAD31338     176 VGDPLVKLVSVMDHAPGHRQSPQLDRFREMQIKQ-YG--WSAEDADRRIEAWIDASRTIg--PQNRSRIIALARARQLPL 250 Mesorhizobium l...
BAB54655     155 VDNPGLRLISMMDHTPGQRQWHNLTLYREFRRKK-NArvWNEEEFALHLAERREHQQQYv--PPGRSTIGHLCRERDIRI 231 Mesorhizobium l...
CAE26133     152 IDRPDIRLMSLMDHTPGQRQFRDEEKLRDYYRGKgAG--MTDAELDVMFARRVYCKENYa--DANMRAIVELAHRYEIPL 227 Rhodopseudomona...
P16689       152 VQREPVTLVSLMDHSPGQRQFANREKYREYYQGK-YS--LTDAQMQQYEEEQLALAARWs--QPNRESIAALCRARKIAL 226 Escherichia col...
CAE26146     152 IGDRRVDLFAFNDHMDTTLANLAKPQKRNRMVER-TG--LSDDEFDRLVERIAARGDEVp--QASR-RLAAIAREVSMPM 225 Rhodopseudomona...
BAB49466     153 MDAGRLDLISLMDHTPGQGQYRDVELYIARIAKE-RG--MSVAAASEVVGKRMAGREGQgnvLNALQDLSARARAAGIVL 229 Mesorhizobium l...
CAB46523     152 LNSDQIDMVSLTDHTPGQGQYNNLQSYILSISER-RA--ISEDMAAEIVAKRIAMRNNPd-iEAKLKEIVALSLRHKLSL 227 Rhizobium legum...
WP_010996374 153 TNHPLLSMISLMDHTPGQRQFIHLDKFKEYYMGK-HG--VTPDQMDEFILIRQQKQAIYa--EKNRIALVELAKTQGISL 227 Nostoc sp. PCC ...
WP_010970699 153 ETDPRVRLISLMDHSPGQRQFQSMDQYIFYYQKK-RG--LSDEAFAEFVRRRQAASAEYs--AKHRDYLAASCAKRGITV 227 Agrobacterium f...
BAC12929     236 ASHDDDNEEKVKLVQSFGTTISEFPITLNVAKEAKNLGLQTIVGAPNVLLGGSHSGNLSAIEAIHEDAADILCSDYFPAA 315 Oceanobacillus ...
CAD31338     251 ASHDDQTPEHVREANDAGVLISEFPTTRAAAEIARSLGICILMGAPNIVRGSSHSGNISARELATTGHLDILASDYVPAS 330 Mesorhizobium l...
BAB54655     232 ASHDDTAAADVDESRGDGITISEFPTTVEAASRARELGMKIVMGSPNIILGGSHSGNVSALELADRGLLDVLTSDYVPGS 311 Mesorhizobium l...
CAE26133     228 ASHDDTTPENVADAIRDRVAVAEFPTTLEAARELHQAGIDILMGAPNVVRGGSHSGNIAAIDLAHEGLLDILSSDYIPSS 307 Rhodopseudomona...
P16689       227 ASHDDATHAHVAESHQLGSVIAEFPTTFEAAEASRKHGMNVLMGAPNIVRGGSHSGNVAASELAQLGLLDILSSDYYPAS 306 Escherichia col...
CAE26146     226 LSHDDDTPAIRQGYRDLGVGIAEFPTTEETARDAALHGDFIVFGSPNVVRGGSHTGWTKAADMIAKGLCSVLASDYYYPA 305 Rhodopseudomona...
BAB49466     230 ASHDDDTLEKVELVHGLGAALSEFPVTLEAAQEARRLGMHTAMGAPNALRGESYSGNLSARQAYQAGLLDMLASDYHPAS 309 Mesorhizobium l...
CAB46523     228 ASHDDDSVEKVAEMHDLGVTISEFPVTAAAAEEARRRGLWTLMGAPNGLRGQSMSGNLSALDAAKAGLLSVIAADYHPAA 307 Rhizobium legum...
WP_010996374 228 ASHDDATVEHVQEAVEDGVVLAEFPTTLEAAKAAHSLGLQVLMGAPNLVLGGSHSGNVSAMELVLHNLVDVISSDYVPQS 307 Nostoc sp. PCC ...
WP_010970699 228 ASHDDATEAHVGEAIGHGVKLAEFPTSVEAAKASHSAGMSVLMGAPNIVRGKSHSGNIAARDLAEIGVLDVLSSDYVPFS 307 Agrobacterium f...
BAC12929     316 LLLAVFQLHEEHQK--ELHEMFKMVTLNPAKAVRMDdELGSIKPGKKADILIINQmEDGYPMLTKTMVNGSLIT 387 Oceanobacillus iheyen...
CAD31338     331 LLHGAFQLTRDPIGm-SLTKAISTVSSVPASVTGFC-DRGMIGIGGRADLCHIVE-IADIPVVRGVWRQGRQVF 401 Mesorhizobium loti R7A
BAB54655     312 LLHAAFALAAK--Gf-DLPEAVAMVTKTPADLLGFS-DRGRIAPGLRADLIRVRL-VEGVPVIRNIWVAGRQYL 380 Mesorhizobium loti MA...
CAE26133     308 LLIAALQLPMRAPGi-DLAAAIRTVTKAPAEAVGLN-DRGEISKGKRADLIRVHV-AHDVPAVRSVWREGQRVA 378 Rhodopseudomonas palu...
P16689       307 LLDAAFRVADDQSNrfTLPQAVKLVTKNPAQALNLQ-DRGVIGEGKRADLVLAHR-KDNHIHIDHVWRQGKRVF 378 Escherichia coli K-12
CAE26146     306 PLLAAFRLVHD--GilPLEQAWKLISENPARAAGLS-ERGTIASGQRADVLLVDDrVALRPRIVAVIAGGRLVH 376 Rhodopseudomonas palu...
BAB49466     310 ILPAVLGLAELRGD--GLAAAAALTSANPANALGLTdR-GAVEPGLLADFVVADRyP--VPRVRATFRAGRMIY 378 Mesorhizobium loti MA...
CAB46523     308 FVPGIFKLADMVEG--GLPAAVAMATGNAARSAGLSdR-GEIAVGQRADLVVVEPgD--INRIRATFRAGRFVY 376 Rhizobium leguminosarum
WP_010996374 308 LLQSIFIIAHKTDK--PIYQAMQLFTSNPAKAINLFgDRGSLEVGKRADFITVHD-DGIVPRLKTTICRGDRVS 378 Nostoc sp. PCC 7120
WP_010970699 308 LLFAPFLLADQVEAi-SLSEALRMVTATPARTVGLV-DRGRIATGLRADLVRVHR-EDGVPVARSVWRQGKRVA 378 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap