1MUM


Conserved Protein Domain Family
prpB

?
TIGR02317: prpB 
Click on image for an interactive view with Cn3D
methylisocitrate lyase
Members of this family are methylisocitrate lyase, also called (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate pyruvate-lyase. This enzyme acts in propionate metabolism. It cleaves a carbon-carbon bond to convert 2-methylisocitrate to pyruvate plus succinate. Some members of this family have been annotated, incorrectly it seems, as the related protein carboxyphosphoenolpyruvate phosphomutase, which is involved in synthesizing the antibiotic bialaphos in Streptomyces hygroscopicus.
Statistics
?
PSSM-Id: 131370
View PSSM: TIGR02317
Aligned: 10 rows
Threshold Bit Score: 437.594
Threshold Setting Gi: 39649314
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MUM_A                5 PGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAgSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVD 84  Escheric...
Q8NSH8               13 RRQAFKAALAAPHIARLPGAFSPLIARSIEEAGFEGVYVSGAVIAA-DLALPDIGLTTLTEVAHRARQIARVTDLGVLVD 91  Coryneba...
CAE80303             11 KRKNFRDALKSGKLLQMPGSWSPLVSMAIEKAGFDGVYISGSVLSN-DLGYPDIGLTSLTEVAQRGRQIARTTKLPTIID 89  Bdellovi...
Q9YFM7               12 PGLVLRELIEKRDIVVAPGVYNPAVALLAERMGFEALYLSGAAITG-SLAMPDLGLITLSELAMFTSYITRVVRVPVIVD 90  Aeropyru...
CAC12351             11 GPATLRDLIKK-DIVVAPGVFSGISALMAERAGFQASYLSGSGVAG-MMGLPDLSVTTLPEIAAEAYRITTVSSLPLIVD 88  Thermopl...
P54528               14 LAGRFRKLMSAPDILQIPGAHDGMAALLAKEAGFSAIYLSGAAYTA-SRGLPDLGIITSAEIAERAKDLVRAADLPLLVD 92  Bacillus...
CAE27836             14 AGVRFRSLIERGGIVRMPGAHNGMAALQARAAGFEALYLSGAAMTA-SMGIPDLGMITVDEVTFFIRQIARAGGLPTLVD 92  Rhodopse...
lhbprmlnih:CBU_0771   3 PGKLFRQAVANEHPLQIVGAINAYCALLAENVGFKAIYLSGGGVAN-TLGLPDLGITDLHDVLEDARRITAATHLPLLVD 81  Coxiella...
AAP76994              4 QGIKLREAVAQNNPLQIIGVINAYSAIQAQKSGAKALYLSGGALAAmSLGVPDLGISSLEDVCIDVRRITAASDLPLLVD 83  Helicoba...
P77541                6 PGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAgSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVD 85  Escheric...
1MUM_A               85 ADIGFGSsAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK-TDPDFVIMARTDALAV 163 Escheric...
Q8NSH8               92 ADTGFGE-PMSAARTVAELEDAGVAGCHLEDQVNPKRCGHLDGKEVVRTDVMVRRIAAAVSAR-RDPNFVICARTDAAGV 169 Coryneba...
CAE80303             90 IDTGFGE-PMSATRTVQEMIEMGLAGCHIEDQINPKRCGHLDGKGLVTRDEAARKVAAAARGKkMDENFLLIARTDARAV 168 Bdellovi...
Q9YFM7               91 ADTGFGE-AINVERTVRELERAGAAAIQIEDQVMPKKCGHLQGKALISPEDMVKKIIAAVGAR-R--DALIVARTDARGV 166 Aeropyru...
CAC12351             89 VDTGFGE-TVNVMRTVRMMEDAGAAAIHIEDQEQPKKCGHLNGKRVIDRDNMVRKIRAAVSTR-KDEDFMIIARTDARSV 166 Thermopl...
P54528               93 IDTGFGG-VLNAARTAREMLEARVAAVQMEDQQLPKKCGHLNGKQLVPIKEMAQKIKAIKQAA-P--SLIVVARTDARAQ 168 Bacillus...
CAE27836             93 GDTGYGE-ALNVMHMVRTFEDAGAGAVHIEDQLLPKKCGHLNDKKLADANDMAAKVAAAAKAR-R--HLYLIARTDAAAS 168 Rhodopse...
lhbprmlnih:CBU_0771  82 IDTGFGG-AFTIARAIKEMERAQVAAVHMEDQVAQKRCGHRPGKELVNTNEMVDRIKAAVDVK-SND-FVLIARTDAYAV 158 Coxiella...
AAP76994             84 ADTGWGG-AFNIARTIKDLTRSGAAGCHIEDQVAQKRCGHRPNKELVSLEEMCDRIKAGVDAK-IDENFVLMARTDAHAS 161 Helicoba...
P77541               86 ADIGFGSsAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK-TDPDFVIMARTDALAV 164 Escheric...
1MUM_A              164 EGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ-VPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAM 242 Escheric...
Q8NSH8              170 EGIDAAIERAKAYLDAGADMIFTEALHSEADFRYFRHAIPdALLLANMTEFGKTTLLSADVLEEIGYNAVIYPVTTLRIA 249 Coryneba...
CAE80303            169 EGLDKAIDRAKAYIDAGADCIFTEALENEKEFETFRKAVn-VPLLANMTEFGKGRLYTYEELSNLGYNIVIYPVTTFRLA 247 Bdellovi...
Q9YFM7              167 EGFEKAVERAQLYVEAGADIIFPEALTSLEEFREFARRVK-APLLANMTEFGKTPYITVDQFREAGYKIVIFPVTTFRAS 245 Aeropyru...
CAC12351            167 NGLEDAIDRANAYLEAGADAVFTEALESREEFVEMRKKVK-GYLMANMTEDGKSPLLSVAELREIGYDIVIFPLTAFRGM 245 Thermopl...
P54528              169 EGLDAAIKRSEAYIEAGADAIFPEALQAENEFRQFAERIP-VPLLANMTEFGKTPYYRADEFEDMGFHMVIYPVTSLRAA 247 Bacillus...
CAE27836            169 EGIDGAVARAKLYIEAGADAIFPEALTTAEMFREFAARMPgVPLLANMTEFGRTPFFTADEFQQMGYRMVIWPVSSLRVA 248 Rhodopse...
lhbprmlnih:CBU_0771 159 EGLKATIDRACTYVEAGADMIFAEALENINDYPTFCKAVK-VPVLANMTEFGKTPLYTAAQLADHGVKMVLYPRSADRAM 237 Coxiella...
AAP76994            162 EGQNRAIERALAYVEAGADMIFAEAIHTLEEYKQFTQNIK-VPVLANITEFGKTPYFTTSELQNVGVKMVLYPLSAARAM 240 Helicoba...
P77541              165 EGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQ-VPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAM 243 Escheric...
1MUM_A              243 NRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFAR 291 Escherichia coli
Q8NSH8              250 MGQVEQALAEIKEHGTQEGWLDRMQHRSRLYELLRYEDYNVFDQHIFTY 298 Corynebacterium glutamicum ATCC 13032
CAE80303            248 MGATVAGLNEIKAKGTQEGLLDKMQTRKDLYALSRYDEYNSFDTSIFNF 296 Bdellovibrio bacteriovorus HD100
Q9YFM7              246 LKASETVLREIMEKGTQKDILDKLYTRTEFYDLIGYHDYEKRDAEVSRK 294 Aeropyrum pernix K1
CAC12351            246 LKAIGDIYRDLLKDGTQRNFLDRIMRRSEFYDVIGYYDYEKEDNVFYKI 294 Thermoplasma acidophilum
P54528              248 AKACERMFGLMKEHGSQKEGLHDMQTRKELYDTISYYDYEALDKTIAKT 296 Bacillus subtilis subsp. subtilis str. 168
CAE27836            249 NKVQQKLYATLHRDGSTQAMLGDMQTRAELYETLGLDRFEALDASIVRS 297 Rhodopseudomonas palustris CGA009
lhbprmlnih:CBU_0771 238 SKAALAVYEDIKKHGVQTASLPFMQTREALYEVLNYHAYEDKLNQLFKR 286 Coxiella burnetii RSA 493
AAP76994            241 NKAALTVFQDIIKNGSQKQSIDSMQTRDELYEMLGYHTFEKKLDELFKH 289 Helicobacter hepaticus ATCC 51449
P77541              244 NRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFAR 292 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap