Conserved Protein Domain Family
propion_prpE

?
TIGR02316: propion_prpE 
propionate--CoA ligase
This family contains one of three readily separable clades of proteins in the group of acetate and propionate--CoA ligases. Characterized members of this family act on propionate. From propionyl-CoA, there is a cyclic degradation pathway: it is ligated by PrpC to the TCA cycle intermediate oxaloacetate, acted upon further by PrpD and an aconitase, then cleaved by PrpB to pyruvate and the TCA cycle intermediate succinate.
Statistics
?
PSSM-Id: 131369
View PSSM: TIGR02316
Aligned: 3 rows
Threshold Bit Score: 1224.38
Threshold Setting Gi: 17428534
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P77495     1 MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARWFCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEE 80  Escherichia coli K-12
CAD15220   5 DAYRALYQRSIDDPAAFWGEQAQRIDWQTPYAAVLDDARLPFARWFVGGRTNLCHNAVDRHLATRGEQAALVYVSTETGI 84  Ralstonia solanacea...
CAA69219   1 MRYEEFHRRSIEQPEAFWAEQARAIHWRTPPQRILDYSNPPFRQWFAGGETNLCYNALDRHLDERGDQLALVTISSETGQ 80  Lysobacter sp. ATCC...
P77495    81 ERTFTFRQLHDEVNAVASMLRSLGVQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIV 160 Escherichia coli K-12
CAD15220  85 ETTYTYRALHREVNRMAACLQALGVRRGDRVLIYLPMIPEAAFAMLACARIGAIHSVVFGGFASNSLATRIDDATPRVIV 164 Ralstonia solanacea...
CAA69219  81 TRELSYRQVHREVNVFASAIRALGVGRGDRVVIYMPNMAEAVFAMLACARIGAVHSVVFGGFAAHNLALRIDDATPKLLI 160 Lysobacter sp. ATCC...
P77495   161 SADAGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAK-MARVSgRDVDFASLRHQHIGARVPVAWLESNETSCILY 239 Escherichia coli K-12
CAD15220 165 SADAGSRGGKVVEYKPLLDAAIDLAVHKPAHVLLVDRKLAP-MQHRP-HDIDYAALARQHTHADVPCEWMESSEPSYILY 242 Ralstonia solanacea...
CAA69219 161 CADAGMRGGKVIPYKPLVDAACAEAQSPPPHVLVVSRGLDPdLRLIPgRDVDYAALRTQHEDAQVEVEWLESNEPSYLLY 240 Lysobacter sp. ATCC...
P77495   240 TSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGSVFFCASDIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWW 319 Escherichia coli K-12
CAD15220 243 TSGTTGKPKGVQRDTGGYAVALAASMPLIFGAQAGDTMFTASDVGWVVGHSYIVYAPLLAGLATVMYEGTPVRPDGAIWW 322 Ralstonia solanacea...
CAA69219 241 TSGTTGKPKGVQRDVGGYAVGLALSMWAIYDIRAGQVMFSTSDVGWAVGHSYNVYGPLIAGATSVLYEGLPTNPDPGVWW 320 Lysobacter sp. ATCC...
P77495   320 TIVEKYQVSRMFSAPTAIRVLKKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA 399 Escherichia coli K-12
CAD15220 323 RIVEQYRVNVMFTAPTAIRVLKKQDPALLRRHDLSSLRRLFLAGEPLDEPTARWIGDALGKPIIDNYWQTETGWPMLAIP 402 Ralstonia solanacea...
CAA69219 321 SICERYGVRTMFSSPTGIRVLKKQDAAWLKKHDLSALHWLFLAGEPLDEPTAHWITDGIGKTVIDNYWQTETGWPVLALM 400 Lysobacter sp. ATCC...
P77495   400 RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDDGRFVKTYWSLFS-RPVYATFD 478 Escherichia coli K-12
CAD15220 403 QGVAPSTPKLGSPGFPVYGYRLDILDEATGQPCAPGEKGLLAVAAPLPPGCMSTVWGDDARFLKTYWSAFPgRPLYSSFD 482 Ralstonia solanacea...
CAA69219 401 PGLDLKPVKFGSPGLPMPGYHLRVIDEATGRDVGPNEKGVLTIVPPLPPGCLSTVWNDDARFLTSYFGHFK-ELLYSSLD 479 Lysobacter sp. ATCC...
P77495   479 WGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSHPGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQ 558 Escherichia coli K-12
CAD15220 483 WGVRDEAGYITILGRTDDVINVAGHRLGTREIEESLSSHPAIAEVAVVGVADPLKGQVAMGFAIVRDAARVAEPAGRMAL 562 Ralstonia solanacea...
CAA69219 480 WAIRDEDGYTFILGRTDDVINVAGHRLGTREIEESVASHASVAEAAVIGVHDELKGQVPVVFATLK----AGDAHDPHAV 555 Lysobacter sp. ATCC...
P77495   559 EKAIMALVDSQIGNFGRPAHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLDQIRQAMEE 628 Escherichia coli K-12
CAD15220 563 EGELMRTVEGQLGAVARPSRVFFVNALPKTRSGKLLRRAMQAVAEGRDPGDLTTIEDPTALAQVREAMQA 632 Ralstonia solanacearum GMI1000
CAA69219 556 ATGMQDCVVRQLGAVARPARVYVVAALPKTRSGKLLRRSIQALAESRDPGDLSTLDDPGALEEVRRALER 625 Lysobacter sp. ATCC 53042
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap