Conserved Protein Domain Family
ABC_phnC

?
TIGR02315: ABC_phnC 
phosphonate ABC transporter, ATP-binding protein
Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 131368
View PSSM: TIGR02315
Aligned: 11 rows
Threshold Bit Score: 375.483
Threshold Setting Gi: 19714739
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE80866       7 LLRVENLSKTYPnGVQALKNINLEVHPGEFLVVIGLSGSGKSTLLRCLNRLQE---PTSG------NIYFSGQEIGQVQd 77  Bdellovibrio ba...
BAC53212       1 MLVVEGLTCRFG-AKAAVDDASFQISPGGFVGVIGRSGAGKSTLLRTINRLVT---PTQG------RILFDGTDVTALR- 69  Bradyrhizobium ...
P16677         4 IIRVEKLAKTFN-QHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITgdkSVGS------HIELLGRTVQREGr 76  Escherichia col...
CAD63316       1 MLKVIQLDKTYGsNKHSLKAVNFTAKPGEVTAIIGPSGAGKTTILRSINQLIR---DDSG------QILLDDTDIRQAN- 70  Lactobacillus p...
BAC12933       3 LLEVNNLGKHYNgDTKVLKNVNFEIGSGEFVSIIGPSGAGKSTLLRCINRMVE---ISEG------SVFVDGQSVGDMK- 72  Oceanobacillus ...
AAQ19835       1 MLEIHNLQKSYStGDKALKGVNLSVQPGELLGLIGPSGAGKSTLIRCVNRLVE---PSEG------RVLLNGKDLANLG- 70  Alcaligenes fae...
O69051        10 VLRVDRLSVVYPgGVTALRDTSIAFRRGEFTVLLGLSGAGKSTLLRSLNRLVT---PTGG------SVTSELGELG--S- 77  Pseudomonas stu...
AAO05897       3 QIEFKDVSKVYPnGHVGLKDINLNIEKGDFAVIVGLSGAGKSTLLRSVNRLHD---ISKG------DITIEGQSITKAR- 72  Staphylococcus ...
CAE76730       1 MIVFNNVNKVWPnGKQVLKNINLEINKGELVAVIGLSGAGKTTLLKTINKIND---ISSGeilidfDKTKEHYEVTKTR- 76  Mycoplasma myco...
AAL95332       4 IIEVKNLVKNYG-DKQILKNISFNINKGEIISIIGESGAGKSTLMRCLNGLEG---INSG------SIKFYDTDITKLK- 72  Fusobacterium n...
WP_010896647   5 ILRVEGLKKVYPdGTVGIKEINTSIRRGELISVIGPSGAGKSTFLRSINRLVE---PTSG------AIFVEGENICNAR- 74  Bacillus halodu...
CAE80866      78 -AEKIRSVRSKMAMIFQHFNLIPRQSVLKNVLMGRLAAKSTWQSLWGMFSDAERIEAKENLRLVGIAEKASLRADQLSGG 156 Bdellovibrio ba...
BAC53212      70 -GKELRQWRARSAMIFQQFNLVGRLDVLTNVLMGRLATMPAWRSLSQTWPEHDKALAMSALEQFDIAALAAQRADQLSGG 148 Bradyrhizobium ...
P16677        77 lARDIRKSRAHTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRTCFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGG 156 Escherichia col...
CAD63316      71 -KAELRKVRHHIGMIFQNYNLISPLTALENVLHGRLGAKSTVAGMLGLYSSAEKQEALQLLDEVGLKEYAYQRCDQLSGG 149 Lactobacillus p...
BAC12933      73 -KKSLRTLRTNIGMIFQHYNLVPRLTVIENVLHGRFGYKTNLQGIFGRFTEKEKEKAFELLDRLGIADHAYKRCDQLSGG 151 Oceanobacillus ...
AAQ19835      71 -RHDLRMARRRIGMIFQEYALVERLTVMENLLSGRLGYSGFWPSWFRRFSPEDIRLAYALLERVGLDGMHNKRADALSGG 149 Alcaligenes fae...
O69051        78 -GSALRQHRRRTAMIFQHHQLIERQSALANVLTGRLAFHNTLR-SLFPLPRADQEIALSCLARVGLADKALSRVDKLSGG 155 Pseudomonas stu...
AAO05897      73 -GKKLLEMRRSIGMIFQHFNLVKRSTVLRNVLSGRVGYHPTWKMILGLFPKEDKVKALDALERVNILDKYDQRSDQLSGG 151 Staphylococcus ...
CAE76730      77 -GKKLQKLRQKIGLMSQEYNNIANKTVLQNVLNARVSSQKGINKILGFFKREDKMIALNSLDKLNLLDYAYIRADNLSGG 155 Mycoplasma myco...
AAL95332      73 -EKEKNSIKKQMAYVFQDLNIIDNMYVIENVLVPFLNRKNFIQVLFNQFSKQEYERALYCLEKVGISKLAYTKAKYLSGG 151 Fusobacterium n...
WP_010896647  75 -GKKLRQMRRKIGMVFQHYNLIKRSSVLQNVLHGRLGYMSTIKGGLGRFHESDTKRALSILKRVGLEEQALKRADELSGG 153 Bacillus halodu...
CAE80866     157 QKQRVAIARALMQKPVLLLADEPVSSLDPATCHVVMDYLRRINQEMGITVIANLHFLSLVRKYATRVVALKDGEIVFRGK 236 Bdellovibrio ba...
BAC53212     149 QQQRVAIARALVQQPDIILADEPIASLDPRNTKIVMDALLRINKHFGITVLCNLHSLDLARSYCDRLIGMAQGRVVFDGA 228 Bradyrhizobium ...
P16677       157 QQQRVAIARALMQQAKVILADEPIASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGS 236 Escherichia col...
CAD63316     150 QQQRVGIARALMQHPKMILCDEPIASLDPKSTTIVMDILRRLAKEKQLIILINLHQVDIAMAYTDHIVGINSGAIVFEGA 229 Lactobacillus p...
BAC12933     152 QQQRVGICRALIQDPKIILCDEPIASLDPNSSKIIMDYLKRITNELGITCLVNLHQVEVAKEYADRIIGLKSGEIVFDGP 231 Oceanobacillus ...
AAQ19835     150 QRQRVGIARALMQKPDLLLVDEPTASLDPKTSRQVMRLVLELCREHGLSAIINIHDVVLATEYLPRIVGLRAGAVVYDGP 229 Alcaligenes fae...
O69051       156 QQQRVGIARALAQQPAIILADEPVASLDPATSVRVLGLLRDICKEDGITAIVSLHQLEYARRFADRVVGLADSQIVFDAA 235 Pseudomonas stu...
AAO05897     152 QQQRISIARALCQEPTIILADEPVASLDPLTTKQVMDDLKKINEELGITILINLHFVDLAKEYGSRIIGLRAGELVYDGP 231 Staphylococcus ...
CAE76730     156 QQQRVALARTLAQQPFLIIADEPVSALDPILANQVMKDFKNINKKDGITVIINIHHVDLAKKYATRVIGLNNGEIVFDDV 235 Mycoplasma myco...
AAL95332     152 EKQRVAIARSLAPNVDLILADEPISSLDEKNSTQIMEIFKRINIKKNKTIILNLHNVEIAKKFSDKILALKNGEIFFYKK 231 Fusobacterium n...
WP_010896647 154 QQQRVGIARAIAQNPTLILADEPIASLDPTASENVLHYMKTICQEEGITTVVNLHQVEFAKKFADRMIGIKAGKIVFDGT 233 Bacillus halodu...
CAE80866     237 PEEITEEWFRRIYG 250 Bdellovibrio bacteriovorus HD100
BAC53212     229 PSALTDHVARELYD 242 Bradyrhizobium diazoefficiens USDA 110
P16677       237 SQQFDNERFDHLYR 250 Escherichia coli K-12
CAD63316     230 TNEVDDAVLQHIYR 243 Lactobacillus plantarum WCFS1
BAC12933     232 SNMLYQDKIESIYG 245 Oceanobacillus iheyensis HTE831
AAQ19835     230 ASAIDTHVLTRIYG 243 Alcaligenes faecalis subsp. faecalis NCIB 8687
O69051       236 PSELTDAQLERIYA 249 Pseudomonas stutzeri
AAO05897     232 ASEANDEVFNHIYG 245 Staphylococcus epidermidis ATCC 12228
CAE76730     236 PSKLDAQAMKKIYG 249 Mycoplasma mycoides subsp. mycoides SC str. PG1
AAL95332     232 SAEVNEDDIRKVYQ 245 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
WP_010896647 234 PRELTDYTVDQLYQ 247 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap