3DHW


Conserved Protein Domain Family
ABC_MetN

?
TIGR02314: ABC_MetN 
Click on image for an interactive view with Cn3D
D-methionine ABC transporter, ATP-binding protein
Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Statistics
?
PSSM-Id: 131367
View PSSM: TIGR02314
Aligned: 4 rows
Threshold Bit Score: 656.57
Threshold Setting Gi: 23396743
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DHW_C   1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKA 80  Escherichia coli K-12
P30750   1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKA 80  Escherichia coli K-12
Q9KTJ5   1 MIEIKSVNKVFYQGDKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLCAA 80  Vibrio cholerae O1 bi...
Q9CK97   1 MIKLEKISKIFDVSGKKLTALDNVSLHVPKGQICGVIGASGAGKSTLIRCVNLLETPSSGAVIVDGKDLTQLKNADLVHE 80  Pasteurella multocida...
3DHW_C  81 RRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPK 160 Escherichia coli K-12
P30750  81 RRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPK 160 Escherichia coli K-12
Q9KTJ5  81 RRNIGMIFQHFNLLSSRTVFENVALPLELAGQSQQHIETKVTELLALVGLSEKRESYPANLSGGQKQRVAIARALASDPK 160 Vibrio cholerae O1 bi...
Q9CK97  81 RRHIGMIFQHFNLLTSRTVFGNIALPLELENTPKEKIHQKVNELLALVGLTDKKDAYPSNLSGGQKQRVAIARALASEPK 160 Pasteurella multocida...
3DHW_C 161 VLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKF 240 Escherichia coli K-12
P30750 161 VLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKF 240 Escherichia coli K-12
Q9KTJ5 161 VLLCDEATSALDPATTQSILELLKEINRQLNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPKTELAHQF 240 Vibrio cholerae O1 bi...
Q9CK97 161 VLLCDEATSALDPATTQSILTLLKEINRTLGITILLITHEMEVVKRICDHVAVIDKGRLIEQGSVSEIFSNPQTQLAKEF 240 Pasteurella multocida...
3DHW_C 241 IQSTLHLDIPEDYQERLQAEP-FTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGT 319 Escherichia coli K-12
P30750 241 IQSTLHLDIPEDYQERLQAEP-FTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGT 319 Escherichia coli K-12
Q9KTJ5 241 IRSTLDLSIPEDYQVRLQPTR-VAGSYPLVRLEFTGATVDAPLMTQIARKYNIDVSILSSDLDYAGGVKFGMMVAEIFGN 319 Vibrio cholerae O1 bi...
Q9CK97 241 IRSTFHISLPEEYMEKLTETPrNATSWPIVKFEFTGRTVDAPVLSQASKMFGVDLSILTSQIDYAGGVKFGFVIAEMEGD 320 Pasteurella multocida...
3DHW_C 320 QQDTQAAIAWLQEHHVKVEVLGYV 343 Escherichia coli K-12
P30750 320 QQDTQAAIAWLQEHHVKVEVLGYV 343 Escherichia coli K-12
Q9KTJ5 320 ADDDEAAIRYLRENNVKVEVLGYV 343 Vibrio cholerae O1 biovar El Tor str. N16961
Q9CK97 321 DEAITRTKTYLMEHNVKVEVLGYV 344 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap