Conserved Protein Domain Family
HpaI-NOT-DapA

?
TIGR02313: HpaI-NOT-DapA 
2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
Statistics
?
PSSM-Id: 131366
View PSSM: TIGR02313
Aligned: 2 rows
Threshold Bit Score: 533.782
Threshold Setting Gi: 46196523
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS80939   2 FRGSIPPLPTPFRR-GRLDEEALRRLVERVVQGGSHGVSVGGTTGEPGTQTLEERKRAIEVVLDQVAGRVPVIPGTGALR 80  Thermus thermophilu...
BAC14823  12 LRGSIAPVITPFKVnGDIDFKKQSELIEFQIENGTHAISVTGTSGEPSSLTTEERVQVMENAIKTINGRIPFAPGTGSTN 91  Oceanobacillus ihey...
AAS80939  81 LEETLELTRFAKEAGAQGAMVIVPYYVKPNQEGLYRYFAEVARAVpDFPLLIYNIPGRAGVEIAPKTVGRLRRDFPNIVG 160 Thermus thermophilu...
BAC14823  92 HDETMYVTKKAEEMGADAAMVIVPYYNKPNQEALYDHFKTVADSV-DIPIIIYNIPGRTAQNMEVKTMARLVKDCPNIVG 170 Oceanobacillus ihey...
AAS80939 161 LKHSSKDLEYLSHLFLEAGRDFLVFCGLESLTLPMMSLGAVGTIAATANWLPKEVALLCEKALAGDYQGARELHFYLLEA 240 Thermus thermophilu...
BAC14823 171 AKESNKDFEHVNRVLLNCGRDFLLFSGIELLCYPMLAIGGAGSISATANVEPKKVAEMHNAWEEGDIKRAQDLHFELMNL 250 Oceanobacillus ihey...
AAS80939 241 NEAIFWDTNPIPLKTVLSWMGLLEKEWRPPLGPTTPEVEERLRRMAERYGLLPK 294 Thermus thermophilus HB27
BAC14823 251 NDVLFKDTNPAPVKAALGMMGMIEPVLRRPMGLPSDALQEEIRDTLVKYGKIEK 304 Oceanobacillus iheyensis HTE831
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap