Conserved Protein Domain Family
HpaH

?
TIGR02312: HpaH 
2-oxo-hepta-3-ene-1,7-dioic acid hydratase
This model represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway in an apparent operon.
Statistics
?
PSSM-Id: 131365
View PSSM: TIGR02312
Aligned: 8 rows
Threshold Bit Score: 488.464
Threshold Setting Gi: 23464539
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE31239       1 MLSEALIGELAAQLYESERTRVQVEHFSKRHPEITIEDGYRISRAWVAMQRADGRRVIGHKIGLTSRAMQQASQIDEPDY 80  Bordetella bron...
AAK03618       1 MLSEAIIQQAAQRLNEAEKTGTQISQFSLAYPEITIEDAYEIQKAWVAMKIAEGRVLKGHKIGLTSKAMQNSSQINEPDY 80  Pasteurella mul...
CAE32080       3 VLDDALLDTLARELYEAEQTRTPIRQLSLRHPALTIEDAYAIQRKWVALKIAAGNPLKGHKIGLTSRAMQAAIGIDEPDY 82  Bordetella bron...
AAD04028       5 AFSDILVNELALELDGAEQTRERVRPFSARYPAMRIEDAYRINQAWVDLKLARGRTVCGHKIGLTSRAMQQAAGITEPDY 84  Novosphingobium...
AAG18491       1 MLDDATIRELAAELHEAERSGVQTKQFSQRFPDIAFEDSYRVQREWMRIKLAEGRRKIGRKIGLTSRAMQKIANITEPDY 80  Sphingopyxis ma...
tigr:BRA1158   1 MLTKDEIEAAAAALDGAEKTRRQVGLLSLKHPGMTMDDAYAVQAAWVKQKIAAGRRVIGWKIGLTSKAMQYALNIDIPDS 80  Brucella suis 1330
BAC94345       1 MLTKEQLQEAAERLYHAEKQREQISALTLQYPEMTMDDAYQIQSEWVGRKVSEGAQVKGYKIGLTSRAMQMAVNIDQPDY 80  Vibrio vulnific...
WP_010889382   1 MLTDEQIRDAAHRLQEAETNRRQIGHLSRQYPDITIEDAYRVQDAWVSHKLAQGRRVYGHKIGLTSRAMQKSSNINEPDY 80  Deinococcus rad...
CAE31239      81 GTLLDHMLYTCqpGQelAIPFERFIAPRVEVELAFVLKAPLRGPEVTVEQVLAATEYVTPAIEIIDSRIEQFDRHTRAMR 160 Bordetella bron...
AAK03618      81 GALLDDMFFEE--NS--EIPFDRFIVPRVEVELAFILKKDLSGPNCTIFDVLDATDYVIPALEIIDARIEQFDSKTKVPR 156 Pasteurella mul...
CAE32080      83 GALLDDMFFAD--GT--TIPAGRFIAPRVEVELAFIMGRRLEGPDVTLFDVLEAARYVTPALEILDARVQMVDPQTRATR 158 Bordetella bron...
AAD04028      85 GTLLDDMVFEQ--GS--DVPAARFITPKVEVELAFVLGRRLEGAQTTIFDVLSATDYVVPAIEIIDTRVHPKDAETGAAR 160 Novosphingobium...
AAG18491      81 GVLLDDMVIAD--GS--TVAPGRFIQPFVEVELAFVLNKDLGGPDVSIFDVLGATEWVVPAVEIIDARIERIDPETGSQR 156 Sphingopyxis ma...
tigr:BRA1158  81 GVLLDDMAFED--GA--VIPADRFIQPRIEAEIAFTMKAPLKGPNVSVFDVLNATDYITPALEILDTRILRVDPETKKTR 156 Brucella suis 1330
BAC94345      81 GVLLDDMFFPD--GA--QIKADDFLDPRIEVELAFVLKEKLEGDGVTIFDVLNATDYVVPALELIAARCHRTDPNTGYTR 156 Vibrio vulnific...
WP_010889382  81 GVLLDDMVFAE--GS--EIPAGRFIVPRVEVELAFLLDKDLSGPHCTVFDVLGATAYVFPAIEIIDARIQQLDPETKATR 156 Deinococcus rad...
CAE31239     161 KVFDTISDNAANAGVVTGAQRVSPQALDLPWCGAVLRQNGVVEETGLAAGVQGHPAIGVAWLANKLAPWGETLEPGQLVL 240 Bordetella bron...
AAK03618     157 RVFDTISDNAANAGVVLGGRAIKPMDVDLRRVAAVLYRNGVVEESGVSAAVLNNPIKGVAWLANKLHPYGVTLKAGEVIL 236 Pasteurella mul...
CAE32080     159 KVTDTISDNAANAGVVLGGRPVRVDEVDLRRVGAILMRNAVVEETGLAAGVLNHPANGVAWLARKLSAHGIALEKDQVIM 238 Bordetella bron...
AAD04028     161 KVLDTISDNAANAGIIVGGLPAKPDGLDLRRIGALLSRNGVIEETGLAAGVLNHPANGVAWLVRRLAPWGQALEAGEVVL 240 Novosphingobium...
AAG18491     157 RVLDTIADNAANAGIVVGSSPVRPDALDLRWVGVTLLKNSVVEETGVGAGVLNHPAKGIVWLARKLSAWDEYLAAGELVL 236 Sphingopyxis ma...
tigr:BRA1158 157 SIVDTISDNAANAGIVIGGRQMRADQVDMRWMGAIVSRNAQMEETGLGAGVLNHPARGIVWLANRLALYGEGIEAGQIVL 236 Brucella suis 1330
BAC94345     157 KVYDTIADNAANAGIILGGRPIKPTEFDLRWAGAMLYLNGQIEETGLAAGVLGHPANGICWVCKRFAPHGVSLEPGQVIL 236 Vibrio vulnific...
WP_010889382 157 KVFDTISDNAANAGIVTGGRPVRPFDFDLRWLGALLYKNGVIEETGVAAGVLNHPANGVAWLANKYAAHGRRLEAGQVIL 236 Deinococcus rad...
CAE31239     241 AGSFTRPVAARKGDAFEADYGPLGAMRFRFV 271 Bordetella bronchiseptica RB50
AAK03618     237 GGSFTRPVAARRGDTFHVDYHELGSISMQFV 267 Pasteurella multocida subsp. multocida str. Pm70
CAE32080     239 AGSFTRPVHAASGDTLSADYGPLGTVSCHFA 269 Bordetella bronchiseptica RB50
AAD04028     241 GGSFTRPVEAAPGDVFNADFGEFGSIGFRFV 271 Novosphingobium aromaticivorans
AAG18491     237 AGSFTRIVPVESGDQICADYGPLGTINVRFE 267 Sphingopyxis macrogoltabida
tigr:BRA1158 237 AGSFIRPVEARHGDTINADFGPYGTIACHFL 267 Brucella suis 1330
BAC94345     237 AGSFTRPVAVKAGDTIHADFGPLGGISVKFV 267 Vibrio vulnificus YJ016
WP_010889382 237 AGSFTRPVEADPGDVFHADYGPLGGVTLRFG 267 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap