Conserved Protein Domain Family
HpaI

?
TIGR02311: HpaI 
2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
This model represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway organized into an operon.
Statistics
?
PSSM-Id: 131364
View PSSM: TIGR02311
Aligned: 6 rows
Threshold Bit Score: 417.25
Threshold Setting Gi: 36959089
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE31240       8 NTFKAALRQGQVQIGLWVGLADPYAAEAVAGAGYDWLLIDGEHAPNDVRQMLSQLQAVAPYPVHPVVRPVIGDVPLIKQI 87  Bordetella bron...
AAK03619       3 NHFKQALKEKKPQIGLWVGLADGYACELAATAGFDWLLLDGEHAPNDLRTLLHQLQTLAAYPTTPIIRPVIGQTHTIKQL 82  Pasteurella mul...
AAS61859      12 NKFKQALKAKKPQIGLWLGLCSNYSAEILAGAGFDWLLIDDEHAPNDVQRILGQLQTIASYPSQPVVRPAWNDPVMIKKL 91  Yersinia pestis...
AAQ87514       6 NRFKQKLLAGQSQIGLWCGLPGSYAAEIVALSGFDWLLFDTEHSPGDVLTVLPQLQAVASYDVSPVVRPAINDPVLIKRF 85  Sinorhizobium f...
BAC94346       7 NQFKQQLHEPQTLWGLWLGLPDTSCAEICGSAGFDWVLIDGEHASFDLTSIKLHLQALAPHSASPIVRAEEANPTLIKRL 86  Vibrio vulnific...
WP_006110397   6 NQFKAALKQGRAQIGLWQALANPYTVEICAGAGYDWLLLDGEHAPNDVPLLVSQLQAMTGSASHPVVRPPVGETWIVKQL 85  Brucella abortus
CAE31240      88 LDIGAQTLLVPVVESAEEAATMVAATRYPPRGIRGVGSALARSSRWNQIPDYLHKADEEMCVLVQVETRAGMEQLDAITQ 167 Bordetella bron...
AAK03619      83 LDIGAQTLLVPMVETAEQARELVKAIHYPPKGVRGVGSALARASRWNSIPHYLQQADEEICLLVQVENKTGLQNLKEIAE 162 Pasteurella mul...
AAS61859      92 LDIGAQTLLLPMIQNAAQARAAISATRYPPQGIRGVGSALARASRWNRIADYVQQADEQICVLLQIETREALRNLPEILA 171 Yersinia pestis...
AAQ87514      86 LDIGVQTLLVPYVQNAEEAKAAVAAVRYPPDGIRGV-SALTRATRFGRVANYAQNAEREICLLLQVETREALGNLEPIAS 164 Sinorhizobium f...
BAC94346      87 LDIGAQTLLLPMINTKQQAEQAVRASYYPPMGERGIGAALARASQWNRIPNYLHQANEQISVLLQVETQQAIDNIEEIAA 166 Vibrio vulnific...
WP_006110397  86 LDIGAQTLLIPMIESREQAEAMVKAMRYPPHGVRGVGSALARASAFNRIPDYLQTANDEVCLLLQVESRAGLANLDAIAT 165 Brucella abortus
CAE31240     168 VEGVDGVFFGPADLSASMGHLGNPGHPDVQAAILDAIRRVRAAGKAPGILTADVKLARQYIEAGALFVAVGVDTTLLVRG 247 Bordetella bron...
AAK03619     163 VDGVDGVFIGPADLSASLGHLGNPSHPEVQQAIEQAIATICAADKAAGILYADEKMAKHYLALGCTFVAVGVDTSLLMRA 242 Pasteurella mul...
AAS61859     172 VDGVDGVFIGPADLASDMGFAGNPHHPEVRQAIDSAVMKIKTADKAAGILMTTPEVAEYYLKLGALFVAVGVDTTLLART 251 Yersinia pestis...
AAQ87514     165 VEGVDGVFVGPADLAASFGHRGQPSHPEVVDAIVDAIERLKALGKPAGILTPDEKFAARCIAMGTLFTAVGVDVAVLARG 244 Sinorhizobium f...
BAC94346     167 VEGVDGIFIGPSDLSGSMGHIGNPSHPEVVAAIDQAIEVIQAHGKAVGILSLDPAQAQQYAKRGVKFIGAGVDTLLLRAG 246 Vibrio vulnific...
WP_006110397 166 TEGVDGVFIGPADLAADMGHLGKPGAQEVQDAVRDALQRIIGHGKAAGILTGDLSLARHYLDLGATFVAIGNDVTLLANA 245 Brucella abortus
CAE31240     248 ARDLVRQFK 256 Bordetella bronchiseptica RB50
AAK03619     243 LNDLSQKFK 251 Pasteurella multocida subsp. multocida str. Pm70
AAS61859     252 AEALAARFG 260 Yersinia pestis biovar Microtus str. 91001
AAQ87514     245 SEALAARFA 253 Sinorhizobium fredii NGR234
BAC94346     247 AESLAQSLK 255 Vibrio vulnificus YJ016
WP_006110397 246 TTRLLADFK 254 Brucella abortus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap