2YYG


Conserved Protein Domain Family
HpaB-1

?
TIGR02309: HpaB-1 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate 3-monooxygenase, oxygenase component
This gene for this monooxygenase is found within apparent operons for the degradation of 4-hydroxyphenylacetic acid in Deinococcus, Thermus and Oceanobacillus. Phylogenetic trees support inclusion of the Bacillus halodurans sequence above trusted although the complete 4-hydroxyphenylacetic acid degradation pathway may not exist in that organism. Generally, this enzyme acts with the assistance of a small flavin reductase domain protein (HpaC) to provide the cycle the flavin reductant for the reaction. This family of sequences is a member of a larger subfamily of monooxygenases (pfam03241).
Statistics
?
PSSM-Id: 131362
View PSSM: TIGR02309
Aligned: 4 rows
Threshold Bit Score: 878.077
Threshold Setting Gi: 46196526
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YYG_A         2 ARTGAEYIEALKTRPPNLWYKGEKVEDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLK 81  Thermus thermop...
BAC14828       3 AKTGQQYIDKLKKANNNVYIHGERVEDVTTHPAFKGAVQSMAKLYDLQYEKPEKMLYTSPTTGDKVSKTFMAPETIEELI 82  Oceanobacillus ...
WP_010889482  20 AVTGQRFLDRLRQNPPTLYIDGQRVADPTTHPSTRNMCQSLAGLYDLQFQEDLKETLTYEDGGKRYARSFMVPRTKDDLR 99  Deinococcus rad...
AAS80942       2 ARTGAEYIEALKTRPPNLWYKGEKVEDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLK 81  Thermus thermop...
2YYG_A        82 RRGQAYKLWADQNLGMMGRSPDYLNAVVMAYAASADYFG------------EFAENVRNYYRYLRDQDLATTHALTNPQV 149 Thermus thermop...
BAC14828      83 ERREAIMEWQGITKGLMGRSPDYLNSEVMTMEKAYDYYGks--------nsLFAENAKKYAEYARENDISLTHTLIHPQV 154 Oceanobacillus ...
WP_010889482 100 LIAESHRIRANYGLGFLGRAPDYMNANVMAAGAGAEYFNgcsaavpgdpkrDFAANMRRYYEYVQGNDLCLTHALTNPQV 179 Deinococcus rad...
AAS80942      82 RRGQAYKLWADQNLGMMGRSPDYLNAVVMAYAASADYFG------------EFAENVRNYYRYLRDKDLATTHALTNPQV 149 Thermus thermop...
2YYG_A       150 NRARPPSGQPDPYIPVGVVKQTEKGIVVRGARMTATFP-LADEVLIFPSTLLQAGSEK--YALAFALPTSTPGLHFVCRE 226 Thermus thermop...
BAC14828     155 NRAKIQAEQKDANVALHVVEKNDDGVIVDGIRLLATQAgITDEIFVFPSTVVKSGAKDdpYSLAFAIANNTPGLRYLSRE 234 Oceanobacillus ...
WP_010889482 180 NRSKMASELPDPYIALGIVEETDEGVIVRGARMMATLP-IADEILIFPSTVLKENADKsrYAMGFGIPTNTPGLSFQCRE 258 Deinococcus rad...
AAS80942     150 NRARPPSGQPDPYIPVGVVKQTEKGIVVRGARMTATFP-LADEVLIFPSTLLQAGSEK--YALAFALPTSTPGLHFVCRE 226 Thermus thermop...
2YYG_A       227 ALVGGDSPFDHPLSSRVEEMDCLVIFDDVLVPWERVFILGNVELCNNAYAATGALNHMAHQVVALKTAKTEAFLGVAALM 306 Thermus thermop...
BAC14828     235 SFDYGKNNFDHPVGSQFEEGDAIVAFDNVLVPWDRIFILEDSEICNGAFAETNAVVHMSHQVIAKDIAKVEFLLGVVLKL 314 Oceanobacillus ...
WP_010889482 259 PIDVGRDPEDHPLSSRFDEQDAFVIFDDVLVPWERIFLLYDVELANKAYAGTDAVLHMAYQVVNLKIAKTEAFLGTAQSI 338 Deinococcus rad...
AAS80942     227 ALVGGDSPFDYPLSSRVEEMDCLVIFDDVLVPWERVFILGNVELCNNAYAATGALNHMAHQVVALKTAKTEAFLGVAALM 306 Thermus thermop...
2YYG_A       307 AEGIGADVYGHVQEKIAEIIVYLEAMRAFWTRAEEEAKENAYGLLVPDRGALDGARNLYPRLYPRIREILEQIGASGLIT 386 Thermus thermop...
BAC14828     315 MDSIGIDGFQHVKDKGTEIMLALENMKSHLYKAEYNAKIDRWGMMTPDFEALNAARNWFPRVYPRLAEILRVLGASGLMG 394 Oceanobacillus ...
WP_010889482 339 VNAIGSGGFQHVQAKIAEIIIMLEIMKALEVAAREQAEPNDYGVMTPARAPLDAARNYYPANHARLPELLQLLGASGIIM 418 Deinococcus rad...
AAS80942     307 AEGIGADVYGHVQEKIAEIIVYLEAMRAFWTRAEEEAKENAYGLLCPDRGALDGARNLYPRLYPRIREILEQIGASGLIT 386 Thermus thermop...
2YYG_A       387 LPSEKDFK-GPLGPFLEKFLQGAALEAKERVALFRLAWDMTLSGFGARQELYERFFFGDPVRMYQTLYNVYNKEPYKERI 465 Thermus thermop...
BAC14828     395 IPTYDDFAnKELGPILNRAMQGKNVEGFERVQLFRLAWDMTMSSFGSRQTHYEYYFFGDPVKMGMAYFDNYDKEPYKAMV 474 Oceanobacillus ...
WP_010889482 419 MPSKADRE-GPLGPQIAKYLQTGNANADERLRLFRLAWDMSMSSFAGRQELYERYFFGDPVRMHSALYEVYDSSEAVARI 497 Deinococcus rad...
AAS80942     387 LPSEKDFK-GPLGPFLEKFLQGAALEAKERVALFRLAWDMTLSGFGARQELYERFFFGDPVRMYQTLYNVYNKEPYKERI 465 Thermus thermop...
2YYG_A       466 RAFLKES 472 Thermus thermophilus HB8
BAC14828     475 DEFLESQ 481 Oceanobacillus iheyensis HTE831
WP_010889482 498 GEFLQRK 504 Deinococcus radiodurans
AAS80942     466 RAFLKES 472 Thermus thermophilus HB27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap