1I7O


Conserved Protein Domain Family
HpaG-N-term

?
TIGR02305: HpaG-N-term 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit
This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related C-terminal domain (TIGR02303). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).
Statistics
?
PSSM-Id: 131358
View PSSM: TIGR02305
Aligned: 7 rows
Threshold Bit Score: 320.53
Threshold Setting Gi: 33567321
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I7O_A         3 GTIFAVALNHRSQLDAWQEAFQQSPYKAPPKTAVWFIKPRNTVIGCGEPIPFPQG-EKVLSGATVALIVGKTATKVREED 81  Escherichia coli
P37352         3 GTIFAVALNHRSQLDAWQEAFQQSPIKAPPKTAVWFIKPRNTVIGCGEPIPFPQG-ENLLSGATVALIVGKTATKVREED 81  Escherichia coli
CAE31234      18 GVVYGALLNQREALDRLGEAVNQPPYKAPPKGPVLYMKPRNTLARDGQAIALAADvPAMRLGATLGLVLGRTACRVDAAE 97  Bordetella bron...
BAC94347       7 GKVVCVALNDAEQLQSMKATFEQAPYKALPTQPVLYFKPHNTWNHAQQPIAYPKG-DELVVGASVALIVGERCCRVNAQS 85  Vibrio vulnific...
AAK03612      18 PTVFVIALNSTQLLQRCQAQFEQAPYQALPKTPVIYVLPEATHNRSGANVSLPAGkKQLRMEPHLAVVFGRDTSRVCVEQ 97  Pasteurella mul...
WP_003113009  11 GTLFGVALNYKGLLDSRLPEFQQPPYQKPPVKPVLFIKTPNTRNEHDAPVLFPRGvERLQPGPALGVVIARDASRVKEEE 90  Pseudomonas aer...
BAC14822      46 GTVYGTLLNYKGEYAELESSMNEDPYKTPPKAPILYIKPINTHIGYGMTIPLPEGvEKVSIGAALGVVIGKPAKNIRKEN 125 Oceanobacillus ...
1I7O_A        82 AAEYIAGYALANDVSLPEESFYRPAIKAKCRDGFCPIG----ETVALSNVDNLTIYTEINGRPADHWNTADLQRNAAQLL 157 Escherichia coli
P37352        82 AAEYIAGYALANDVSLPEESFYRPAIKAKCRDGFCPIG----ETVALSNVDNLTIYTEINGRPADHWNTSDLQRNAAQLL 157 Escherichia coli
CAE31234      98 ALDYVAGVVLVADLTVPHDSFYRPSARFVARDRSCFIGprivPLAEAGDPDAMVIHVTVDGKPAQAASMGGRVRPAARLL 177 Bordetella bron...
BAC94347      86 ALDYVAGVALLHDFSLPETSYYRPDIKGKCLDNSATLSqa-lMLSDIGDLSQQTVTTYINDKQVQSLPLSRLERSAEQLI 164 Vibrio vulnific...
AAK03612      98 AMHYVSGYLPVALYSLPHDSYYRPDIEGRCQEGFCVLGqe-vLKSAVQNPAELTINITVNGSVKKSYVHLAMKHSIPELI 176 Pasteurella mul...
WP_003113009  91 AMAHVAGYVIVNEFSLPEDSYYRPAVKAKCRDGFCPLGpqlvPVQEIVDPHALELKLYVNGELRQRNNTANLVRDIPRLI 170 Pseudomonas aer...
BAC14822     126 ALDYVAGYTIVNDVSIPNESYYRPAYKEKARDGFCPIGpwvlRRDAIENPNELGIRVYINGEIKQENTTSNLIRSVEQLM 205 Oceanobacillus ...
1I7O_A       158 SALSEFATLNPGDAILLGTPQARVEIQPGDRVRVLAEGFPPLENPV 203 Escherichia coli
P37352       158 SALSEFATLNPGDAILLGTPQARVEIQPGDRVRVLAEGFPPLENPV 203 Escherichia coli
CAE31234     178 ADVTDFMTLSPGDILLLGTCVDQPQVGRGQAFALAAEGMGELHGET 223 Bordetella bronchiseptica RB50
BAC94347     165 ELISHIMTLEKGDVIAIGFAGERTKLSPGYVVRSALGESVELENQV 210 Vibrio vulnificus YJ016
AAK03612     177 SFLSQFIAFKAGDILLTGTEDMPLLVGAGDQVSVEFAQLGCLTNTV 222 Pasteurella multocida subsp. multocida str. Pm70
WP_003113009 171 AEISEFMTLHAGDVLITGTPEGRVDVHPGDRVEVEIDGLGRLANSI 216 Pseudomonas aeruginosa
BAC14822     206 EEVTDFMTLYEGDVLLVGVPENAPIAKENDRVIIEIDNIGTLVNKV 251 Oceanobacillus iheyensis HTE831
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap