1WZO


Conserved Protein Domain Family
HpaG-C-term

?
TIGR02303: HpaG-C-term 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit
This model represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation. In E. coli and some other species this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (TIGR02305). In other species such as Pasteurella multocida these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).
Statistics
?
PSSM-Id: 131356
View PSSM: TIGR02303
Aligned: 5 rows
Threshold Bit Score: 429.232
Threshold Setting Gi: 46196524
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WZO_A     2 KLARFLAKGRVHQGVYR-EGLLLDEAGEAHRPEDVTWLLPFTP-GKILGVALNYADHAEELG--LSRPeEPALFWKPNTS 77  Thermus thermophilu...
BAC14821   2 RHARIAYNGLIQHAVET-NEGIKLEDGRIVNESQVTWLPPVEP-KTVFTLGLNYADHAAELSfkEAPK-EPLVFLKGPNT 78  Oceanobacillus ihey...
AAK03613   3 KYAKVMYQNQIHSVEVR-PNGLLTDQQQLLPSEAVTWLPPAS--GMMYALGLNYADHASELD--FKPPeKPLVFVKTHHT 77  Pasteurella multoci...
AAS80940   2 KLARFLAKGRVHQGVYR-EGLLLDEAGEAHRPEDVTWLLPFTP-GKILGVALNYADHAEELG--LSRPeEPALFWKPNTS 77  Thermus thermophilu...
BAC94348   2 KRARIEYLGDVLSVTIGdGDNAITADGRSLPAGQFTWLSPIENpGTIFALGLNYADHASELA--FEPPkEPLVFLKGANT 79  Vibrio vulnificus Y...
1WZO_A    78 LLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVRAKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPF 157 Thermus thermophilu...
BAC14821  79 FIGHLGETYRPSDVTFMHYECELAVVIGKTAKNVKKEEAYNYVRGYTVANDYALRDYLENYYRPNLRVKNRDTCTPIGPW 158 Oceanobacillus ihey...
AAK03613  78 YTGHNSTTWRPDNVDYMHYECELVVVIGKTAKNVKRDEAMDYVAGYTLCNDYAIRDYLENYYRPNLRVKNRVGTTPVGPW 157 Pasteurella multoci...
AAS80940  78 LLPHKGVVLYPKGARFVHYEVELAVVVGRPMKKVKAKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFLPLGPF 157 Thermus thermophilu...
BAC94348  80 LTAHQQPSYRPNDIEFMHYECELVAVVGKEARNVKREDAMDYIQGFTICNDYAIRDYLENYYRPNLRVKSRDSLCPIGPW 159 Vibrio vulnificus Y...
1WZO_A   158 LV-VEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLG 236 Thermus thermophilu...
BAC14821 159 VVdKEDIEDPMNLQLTTYVNGEITQQGSTADMIFSVPHLIEYLSGLMTLNPGDIILTGTPKGSVDTKVGDEVITEVEGVG 238 Oceanobacillus ihey...
AAK03613 158 IVdKADVKDPMNLTLRTWVNGELCQEGNTKDMIFDIAYLIEHLSHITTLQPGDMIATGTPKGLADVKPGDCVEIEIEQIG 237 Pasteurella multoci...
AAS80940 158 LV-VEEVEDPQDLWLRAYVNGELRQEGHTSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVRPGDVMRLEIEGLG 236 Thermus thermophilu...
BAC94348 160 IVdCDDIEDVNNLALTTHVNGELTQQGNTSDMIFDVPFLIEYLSSFMTLKPGDLIATGTPKGLKDIQPGDVVRCTIEGVG 239 Vibrio vulnificus Y...
1WZO_A   237 ALENPIEEE 245 Thermus thermophilus HB8
BAC14821 239 RLVNTIVGE 247 Oceanobacillus iheyensis HTE831
AAK03613 238 KLTNYIVSE 246 Pasteurella multocida subsp. multocida str. Pm70
AAS80940 237 ALENPIEEE 245 Thermus thermophilus HB27
BAC94348 240 SLENPVLSE 248 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap