Conserved Protein Domain Family
TIGR02301

?
TIGR02301: TIGR02301 
TIGR02301 family protein
Members of this uncharacterized protein family are found in a number of alphaProteobacteria, including root nodule bacteria, Brucella suis, Caulobacter crescentus, and Rhodopseudomonas palustris. Conserved residues include two well-separated cysteines, suggesting a disulfide bond. The function is unknown.
Statistics
?
PSSM-Id: 131354
View PSSM: TIGR02301
Aligned: 6 rows
Threshold Bit Score: 158.792
Threshold Setting Gi: 499273971
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BR0671    6 RLFRLAAGAAALWLAVCPPVLAQDAPYEGKMLRLAEVLGSLHYLRNLCGEKG-SEWRDRMDAIIAAEKPPE-AERLKLVS 83  Brucella suis 1330
BAB54181       4 APFLVALCLAASTAVAVRPAFSAESPFEPGLMRLAEVLGSLHFLRNLCGEKG-DQWRGEMEKLLDSENPDP-ERRARFIA 81  Mesorhizobium l...
CAC45686      24 AAQEKQPAPQTTAPSPSPAQEEKPTPYDQRLIRLAEILGSVHYLRNLCLDQSeDGWRRSTQELIDKEAAGEpKRRERITA 103 Sinorhizobium m...
BAC47826       3 TRFLAIFALILACASVPTRAQDVAAPFDADLQRLAEILGGLHYLRGICGSNEgNKWRSEMQALIDAETPSG-ERRTRMIA 81  Bradyrhizobium ...
AAK25338       3 RPFLIGVCLASLIAAPVLAQERAPE-DRQRLLDIAYALGESHALRQTCQGEGdQYWRSRMVRLTEVEQADQ-AFDAQMRE 80  Caulobacter cre...
WP_010971364  22 GVAYAQPSKSVSEARPAEAAPPKPAPYDDKLARLSEILGAVQYLRTLCPSSGpEDWRKSMSALLAADTASEpERRQRMTA 101 Agrobacterium f...
tigr:BR0671   84 SFNHGYRVFSDNYARCTPSALAAIDRYMKEGGDLSNEIISRY 125 Brucella suis 1330
BAB54181      82 SFNRGYRSFGGTYTQCTASATEAISRYMKEGETLSRDIASRY 123 Mesorhizobium loti MAFF303099
CAC45686     104 AFNRGYRTFASVYTRCTEPATLAEERYRAEGATLASEIVARF 145 Sinorhizobium meliloti 1021
BAC47826      82 GFNRGYNGFQQTYRSCTPAATVAIRRYIEEGSKISRDLTARY 123 Bradyrhizobium diazoefficiens USDA 110
AAK25338      81 RFNTGFASRRSEYPICDDASRKAEQAVARKGQALALKLSQTM 122 Caulobacter crescentus CB15
WP_010971364 102 AFNRGYRSFAAIHTSCTRAAIMAEENYRNEGATLAQEIASRF 143 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap