2D4E


Conserved Protein Domain Family
HpaE

?
TIGR02299: HpaE 
Click on image for an interactive view with Cn3D
5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
This model represents the dehydrogenase responsible for the conversion of 5-carboxymethyl-2-hydroxymuconate semialdehyde to 5-carboxymethyl-2-hydroxymuconate (a tricarboxylic acid). This is the step in the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate following the oxidative opening of the aromatic ring.
Statistics
?
PSSM-Id: 131352
View PSSM: TIGR02299
Aligned: 6 rows
Threshold Bit Score: 828.293
Threshold Setting Gi: 33567323
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D4E_A    27 ALHFIAGEFVPSESgeTFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQ-RWSRTKAKERKRYLLRIAELIEKHADE 105 Thermus thermophilu...
CAE31236   3 IEHLIDGKAVAGKQ--YFETINPATQETLAEVAAGGEAEVHAAVAAAKAAFP-KWAGLPAAERARLVRKLGDLIAAHVPE 79  Bordetella bronchis...
BAC14825  24 IKLYINGEFMDAEDrgTFDNISPFSNEKINSVASGQAADIDKAVQSAKKAFKgEWGNLKQVERLEYVYKIGDLIEQHTDE 103 Oceanobacillus ihey...
BAC48233  30 IGHMIDGKIVPSISgeTFETKSPVDGAVLASVARGNAEDIDRAATAAALAFK-SWREMGPAMRKKLLHRVADAIEDNADD 108 Bradyrhizobium diaz...
BAC94349  24 LGHFINGEWTLGSKgeTFDNLTPTDNTSLGKVVKGTAEDVDAACEAAQQAFT-AWAEMSGAERKKILHKLADKIEQRAEE 102 Vibrio vulnificus Y...
AAS80941  27 ALHFIAGEFVPSESgeTFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQ-RWSRTKAKERKRYLLRIAELIEKHADE 105 Thermus thermophilu...
2D4E_A   106 LAVMECLDAGQVLRIVR-AQVARAAENFAFYAEYAEhAMEDRTFPVDrDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIA 184 Thermus thermophilu...
CAE31236  80 ISRTETNDCGQTIAQTGkQLVPRAADNFYYFAEMCT-RVDGHTYPTP-THLNYTLYHPVGVCALISPWNVPFMTATWKVA 157 Bordetella bronchis...
BAC14825 104 IAILESLDTGLPISQTR-KQVSRSANNFRFYADTVKsQMYGEVYQVDdEFINYTVRSAVGVAGLITPWNAPFMLETWKIA 182 Oceanobacillus ihey...
BAC48233 109 IAVLECIDTGQAYRFMA-KAAIRAAENFRFFADKCAeARDGQNTPSD-EHWNVSTRVPIGPVGVITPWNTPFMLSTWKIA 186 Bradyrhizobium diaz...
BAC94349 103 IALVESMDCGQPLRFMR-QAAIRGAANFRFFADKSPeAKNGLSLHQD-THTNYTIRTPIGPVGVITPWNTPFMLSTWKIA 180 Vibrio vulnificus Y...
AAS80941 106 LAVMECLDAGQVLRIVR-AQVARAAENFAFYAEYAEhAMEDRTFPVDrDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIA 184 Thermus thermophilu...
2D4E_A   185 PALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNaaDH 264 Thermus thermophilu...
CAE31236 158 PCLAFGNTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGRDAGEPLVAHPDVRAVSFTGSTATGNRIVQA--AG 235 Bordetella bronchis...
BAC14825 183 PALATGNTVILKPAEWSPLTANRMAEIIDQAGLPDGVFNIVHGFGETAGDALVKHPDVQLISFTGETTTGSTIMRNgaDA 262 Oceanobacillus ihey...
BAC48233 187 PALAAGCTVVHKPAEWSPATAAILARLVKEAGVPDGVLNTVHGFGEEAGKALTEHPAIKAIGFVGESATGSAIMVQgaPT 266 Bradyrhizobium diaz...
BAC94349 181 PALAAGCTVVHKPAEFSPLTAAILAECAKEAGLPDGVWNMVNGFGEVAGKTLTEHKAIKAVAFVGETVTGSMIQAQgaPT 260 Vibrio vulnificus Y...
AAS80941 185 PALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNaaDH 264 Thermus thermophilu...
2D4E_A   265 LKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEV 344 Thermus thermophilu...
CAE31236 236 LKKFSMELGGKSPFVIFDDADLDRALDAAIFMIFSNNGQRCTAGSRILVQQSIYADFTQKFVERARRIRVGDPLDEGTIV 315 Bordetella bronchis...
BAC14825 263 LKRFSMELGGKSPIIVFEDADLERALDAATWGIFSFNGERCTANSRLYLHESIADEFIEKLKQRVWNIRVGDPLENNTQI 342 Oceanobacillus ihey...
BAC48233 267 LKRVHFELGGKNPVIVFDDADLDRALDAVVFMIYSLNGERCTSSSRLLIQQSIAEKFVEKLTARVKALKVGHPLDPSTEI 346 Bradyrhizobium diaz...
BAC94349 261 LKRVHFELGGKNPVIVFDDADFERALDAVVFMIYSLNGQRCTSSSRLLIQNGIKPKFIEALKQRVESLQVGHPLDPETEV 340 Vibrio vulnificus Y...
AAS80941 265 LKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEV 344 Thermus thermophilu...
2D4E_A   345 GPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKTs--FRGEDLSRGNYLLPTVFVGEn-HMKIAQEEIFGPVLVAIPFK 421 Thermus thermophilu...
CAE31236 316 GPLISPAHLAKVRGYIELGSKEGATMLCGGLDRPSyapELDARVRDGNFVWPTVFADVdnRMKIAQDEIFGPVACLIPFR 395 Bordetella bronchis...
BAC14825 343 GPLIKTEHYNNVKKYLKIAEEEGCEIISG---------VIPKELNRGNYVAPTILLNAsnEMRVVQEEIFGPVIAVMTFN 413 Oceanobacillus ihey...
BAC48233 347 GPLIHERHLAKVCSYFDVARKDGATIAVGGKAYDG--------PGGGHYVEPTLVTGAhgKMRVAQEEVFGPFLTVLPFK 418 Bradyrhizobium diaz...
BAC94349 341 GPLVHQSHYNKVMSYMTAAEEDGATIAVGGRKLPE--------KGAGNYLTPTLFTDAdnTMRIAREEIFGPVLTCIGFD 412 Vibrio vulnificus Y...
AAS80941 345 GPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKTs--FRGEDLSRGNYLLPTVFVGEn-HMKIAQEEIFGPVLVAIPFK 421 Thermus thermophilu...
2D4E_A   422 DEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTI 501 Thermus thermophilu...
CAE31236 396 DEAHAIELANDIEYGLSSYVWTESVGRAHRVAAAIEAGMCFVNSQNVRDLRQPFGGTKASGTGREGGTWSYEVFCEPKNV 475 Bordetella bronchis...
BAC14825 414 DETEVIEKANDVRYGLAGYVWTNDMKRGHRVAHAIDSGMLWVNSQNVRDLRTPFGGSKDSGIGREGGHYAFEFYTEQKII 493 Oceanobacillus ihey...
BAC48233 419 DEADAIEVANDIRYGLTGYVWTNDVGRALRVADALEAGMIWLNSENVRHLPTPFGGMKASGIGRDGGDYSFDFYMETKHV 498 Bradyrhizobium diaz...
BAC94349 413 SEEEALEIANDTDYGLSGYIWTSNTGRAMRMATKVEAGMIWVNSENNRNLPSPFGGVKMSGIGRDGGDWSFDFYMETKNV 492 Vibrio vulnificus Y...
AAS80941 422 DEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTI 501 Thermus thermophilu...
2D4E_A   502 ALPLRPPHVPKFGK 515 Thermus thermophilus HB8
CAE31236 476 AVSLGNHHIPHWGA 489 Bordetella bronchiseptica RB50
BAC14825 494 HVAIGDHHIPQFGK 507 Oceanobacillus iheyensis HTE831
BAC48233 499 SLARGTHKIQKLGI 512 Bradyrhizobium diazoefficiens USDA 110
BAC94349 493 CIAHDLHRVPTLGK 506 Vibrio vulnificus YJ016
AAS80941 502 ALPLRPPHVPKFGK 515 Thermus thermophilus HB27
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap