Conserved Protein Domain Family
HpaD_Fe

?
TIGR02298: HpaD_Fe 
3,4-dihydroxyphenylacetate 2,3-dioxygenase
This enzyme catalyzes the ring-opening step in the degradation of 4-hydroxyphenylacetate.
Statistics
?
PSSM-Id: 131351
View PSSM: TIGR02298
Aligned: 4 rows
Threshold Bit Score: 498.221
Threshold Setting Gi: 39648583
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC94352  59 MGKLCIAAKITHVPTMIMSEQP-GRLFGCRQAAIDGHKEIAKMAKEMDVDTIIVLDTHWLVNAGYHINSNDSFSGNYTSH 137 Vibrio vulnificus Y...
CAE31237   3 MGKLALAAKITHVPSMYLSELD-GPNKGCRQAAIDGHKEISRRCRELGVDTIVVFDVHWLVNSDYHINCAPRFSGCYTSN 81  Bordetella bronchis...
AAP19576   1 MGKLALAAKITHVPSMYLSELP-GKNHGCRQGAIDGHKEISKRCREMGVDTIIVFDTHWLVNSAYHINCADHFEGVYTSN 79  Shigella flexneri 2...
CAE27104   1 MGKLVLAAKVSHVPSLMLSETSdSPLRQARAGAVAALRELGRRAKEREVTTFVVFDTHWLSNFGYHINANAQHRGSFTSH 80  Rhodopseudomonas pa...
BAC94352 138 EFPHFIQNLEYQYRGNRALGDLIADKATEKGVFTLSHQVDSLDLEYGTLVPMRFMNQDNHFNVVSVAAWCTVHNIESSRI 217 Vibrio vulnificus Y...
CAE31237  82 ELPHFIKNMDYEYPGNPALGHLIADVANEMGVATRAHSETSLGMEYGTLVPMRYMNEDQHFKVVSVSGWCVWHDLATSVR 161 Bordetella bronchis...
AAP19576  80 ELPHFIRDMTYNYEGNPELGQLIAEEALKLGVRAKAHNIPSLKLEYGTLVPMRYMNEDKHFKVVSISAFCTVHDFADSRK 159 Shigella flexneri 2...
CAE27104  81 EAPHMIQDLRYDLPGDPALAQAIAAEAQSHGLKVLAHQVPTLGLEYGTIVPMHYLNSDGWAKIVSIASP-LFTSIEESRA 159 Rhodopseudomonas pa...
BAC94352 218 LGEAIREAVEQ-SDSRVMLLASGSLSHRIWDNDeyEANNGTFTISKEFNRQVDLRVLELWRNRDYTTFLEMLPDYAALCS 296 Vibrio vulnificus Y...
CAE31237 162 FGQAVRKAIEErYDGTVAVLASGSLSHHFAENG--TAPEYMHKVWDPFLEQVDRRVVELWEQGDWQTFCPMLKLYAEQCW 239 Bordetella bronchis...
AAP19576 160 LGEAILKAIEQ-YDGTVAVLASGSLSHRFIDDQ--RAEEGMNSYTREFDRQMDERVVKLWREGQFKEFCNMLPEYADYCY 236 Shigella flexneri 2...
CAE27104 160 LGEATRRAIDA-SDERVAILASGSLSHRLWPNKd-LGPDAWTTIASEFNRQVDLRVLQLWQERRYREFTAMLPDYAVKCN 237 Rhodopseudomonas pa...
BAC94352 297 GEGGMHDTAMLFGALGWDQYQGESTVITEYFPSSGTGQVNVVFEV 341 Vibrio vulnificus YJ016
CAE31237 240 GEGGMHDTAMLLGALGWTDYDQPVEVVTPYFGSSGTGQINAIFPV 284 Bordetella bronchiseptica RB50
AAP19576 237 GEGNMHDTVMLLGMLGWDKYDGKVEFITELFPSSGTGQVNAVFPL 281 Shigella flexneri 2a str. 2457T
CAE27104 238 GEGGMADTVMLFAALGWDDYTGEAEPLCDYFPSSGSGQVNVEFHV 282 Rhodopseudomonas palustris CGA009
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap