Conserved Protein Domain Family

TIGR02297: HpaA 
4-hydroxyphenylacetate catabolism regulatory protein HpaA
This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.
PSSM-Id: 131350
Aligned: 4 rows
Threshold Bit Score: 461.581
Threshold Setting Gi: 37198519
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAK03608     275 IERQIQEAKRKLLFTQHSIYQIAYDLGFKDPAYFSRFFQKETQLSPKAFRDQ 326 Pasteurella multocida subsp. multocida str....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap