Conserved Protein Domain Family
HpaA

?
TIGR02297: HpaA 
4-hydroxyphenylacetate catabolism regulatory protein HpaA
This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.
Statistics
?
PSSM-Id: 131350
View PSSM: TIGR02297
Aligned: 4 rows
Threshold Bit Score: 461.581
Threshold Setting Gi: 37198519
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAN45793      10 GYENIDLVREYDARYAGEDVHYETFARLANFFGRDMRPHWHDRYFQLHYLVTGRITLQLDEHFYSVRAPLFVLTPPSVPH 89  Shigella flexne...
AAK03608      41 ETQNINIEKTYGGQESSSIIHYETFDNLALFYGRKSLVHFHDRFYQVHYLTEGSIALQLDAHEYRLYAPCFFITPPSIPH 120 Pasteurella mul...
BAC94354       5 AIPNLDIGKVYDSRYDDSDFHIERLDSLALFFGRNMPTHYHDRYYQLHIILEGTTHVLLDQAHYSETGTTLFFTPPTVPH 84  Vibrio vulnific...
WP_003113010   6 PIPNINIGQVYDQRYADAEVHYDALGNLAGFFGRNMPAHRHDRFFQVHYVKNGAVRVYLDERQYLESGPMFFLTPPTVPH 85  Pseudomonas
AAN45793      90 TFFTDPDSDGHVLTVRQELIWPLVEKLWP---GSGdAAMLQGICLSLEG--MEHTLAALNHYWPIISLEFQQNKQGREIL 164 Shigella flexne...
AAK03608     121 GFYTDLDTHGHVLTIPQEFVWQLLESLKR---DIN-YFYPMCIELSPQE--EAQQIFKFEYLFNLLAGEYRQHTDEKQTA 194 Pasteurella mul...
BAC94354      85 SFVTDDYANGYVITASQPLVWRLLDIEIGrndVAStALQPFCTRL--------ENPSKLLSLLEMLLSEQGNTEFMSDVA 156 Vibrio vulnific...
WP_003113010  86 AFVTEADADGHVLTVRQQLVWSLTEAEPGl--APGpQVAPACVALGNLEggAAEEAARLALLFEQLRSESMASRSGRQQA 163 Pseudomonas
AAN45793     165 LQSLAQSIFTILLREAPPNDISTCSVRGEMCLFQKFNRLIDENYRQHLMVPEYATMLGMSESRLTELCRRFANQSPKRLI 244 Shigella flexne...
AAK03608     195 LRLSAKLILLEIYRLSKSNEKKYSPRNNELYLFNQFNFLIEDNFKNNWRINDYLDRLCISESKLNAICQHFSATSPKRLI 274 Pasteurella mul...
BAC94354     157 NQALFQLVLIDVMRHSNTQPVSTMFRSADVAIFNRFNQMIEINYKQHLTLPEYTEQLGLTTARLNDICRKISGLSSKRLV 236 Vibrio vulnific...
WP_003113010 164 LLALTRLVMISLLRLSANSVAARPMRHEDLQIFQRFNALIEERYAEHWPLSLYASRIGVTEARLNDVCRRIADLPSKRLV 243 Pseudomonas
AAN45793     245 FERVSREARRLLLYSEQSINQIALDLGYKDPAYFARFFNRMMGCSPTQFRGR 296 Shigella flexneri 2a str. 301
AAK03608     275 IERQIQEAKRKLLFTQHSIYQIAYDLGFKDPAYFSRFFQKETQLSPKAFRDQ 326 Pasteurella multocida subsp. multocida str....
BAC94354     237 AERVMQEARRLLLLTPMPVSQVAYELGYQDPAYFARFFKKQVGETASDFRIN 288 Vibrio vulnificus YJ016
WP_003113010 244 YERLMQESKRLLLFTGGSVNEICYQLGFKDPAYFSRFFVRYAGLTPSAYRQR 295 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap